KEGG   Brucella ovis: BOV_2037Help
Entry
BOV_2037          CDS       T00534                                 

Gene name
pheS
Definition
phenylalanyl-tRNA synthetase subunit alpha (EC:6.1.1.20)
Orthology
K01889  
phenylalanyl-tRNA synthetase alpha chain [EC:6.1.1.20]
Organism
bov  Brucella ovis
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:bov00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2048385..2049494
Genome map
AA seq 369 aa AA seqDB search
MSDLEQLERQILEDIAAAVDEQGIEAVRVAALGKKGTVSEKLKTLGGMSPEERQMQGPAI
NGLKNRVTEALSERRTELRKAAVAARLEREKVDVTLPVRESAASRGRIHPISQVIDEITA
IFADMGFSIAEGPDIETDYYNFTALNFPEGHPAREMHDTFFFNPDEKGERKLLRTHTSPV
QVHTMEKFAAMRDKEGRDEPIRIVIPGKTYRMDSDATHSPMFHQVEGLVVDKSANVVNMK
WVLEEFCKAFFEVPSVKMRMRPSFFPFTEPSVEVDIQCDRSGPHVKFGEGNDWLEILGCG
MVHPNVLRMSGYDPEVYQGFAWGMGIDRIAMLKYGMPDLRAFFDADVRWIEHYGFRPLDI
PTLFGGLSA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatctagaacaactcgaacgccagattctcgaagacattgccgcggcagtggat
gagcagggtattgaggccgtgcgcgtggcagcgcttggcaagaaaggcacggtttcggaa
aagctgaagacgctgggcggcatgtcgccggaagagcgccagatgcaggggccggccatc
aatggcctgaagaaccgcgtcaccgaggccttgagcgagcgcaggaccgaactgcgcaag
gcggcggttgccgcgcgtctggagcgtgaaaaggttgatgtgacgctcccggtgcgtgaa
agcgcggcatcgcgcgggcgcatccatcctatttcgcaggtgatcgacgagatcacggcg
attttcgcggatatgggtttttccattgccgaaggtccggatatcgagaccgactattat
aatttcaccgcgctcaacttccccgaaggccatccggcgcgcgagatgcacgacacgttt
ttcttcaacccggatgaaaagggcgagcgcaagttgctgcgcacgcacacttcgccggtg
caggtgcatacgatggagaagttcgccgccatgcgcgataaggaaggccgcgacgagccg
attcgcatcgtcatccccggcaagacctatcgtatggattccgacgccacccattcgccg
atgttccatcaggtcgaggggctggtggtcgacaagtcggccaatgtcgtcaatatgaag
tgggtgctggaagagttctgcaaagccttctttgaagtgccttcggtgaagatgcgtatg
cgcccgtccttcttcccgttcaccgagccgtctgttgaagtcgatatccagtgcgaccgc
tccggcccgcatgtgaaattcggcgagggcaatgactggctggaaattctgggctgcggc
atggtgcatcccaatgtcttgcgcatgtcgggctatgacccggaagtctatcagggcttt
gcctggggcatgggcatcgaccgcattgccatgctgaaatacggaatgccggatctgcgc
gccttcttcgacgccgatgtgcgctggatcgagcattacggtttccgtccgctcgacatt
ccgacgcttttcggcggattgagcgcgtaa

DBGET integrated database retrieval system