KEGG   Bordetella parapertussis 12822: BPP3638Help
Entry
BPP3638           CDS       T00140                                 

Definition
beta-D-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bpa  Bordetella parapertussis 12822
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bpa00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:bpa00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
3933869..3934669
Genome map
AA seq 266 aa AA seqDB search
MNPARPLHGRCALITGAEAGLGLAIADTLARSGADIVMHCLQANESARQAQAALAREHGV
RVLLLQADLRDVDQIEAMAAQALAELPRLDILVNNAVVRHFEPAHELPRAHWDESLAVNL
SAAFHLARLALPGMLAQGWGRIINLSSVYGAGAAANRVGYVTTKTALLGLTRALAVETAA
SGITCNAVAPGTAPTPAIVGRIAEIARRDGVAQEQAEREYLAAARQPTGRFVAMENVAAL
VAFLCSDAGRDITGATLPIDGGWTAA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaacccggcccgcccgctacacgggcgctgcgccctgatcaccggcgccgaggccgga
ctggggctggccatcgccgatacgctggcccgttccggcgccgacatcgtgatgcactgc
ctgcaggccaacgaaagcgcccgccaggcgcaagccgccctggcgcgcgagcacggcgtg
cgggtgctgctgctgcaggccgacctgcgggacgtggaccagatcgaggccatggcggct
caggcgctggccgagctgccgcgcctggacatcctggtcaacaacgccgtggtgcgccat
ttcgagccggcccatgaactgccgcgcgcccactgggacgagtcgctggccgtcaacctg
tcggcggcgttccacctcgcccgcctggcgctgccgggcatgctggcgcagggctggggc
cgcatcatcaatctgtcgtcggtctatggcgcgggagccgcggccaaccgggtcggctac
gtcaccaccaagaccgccctgctgggactgacccgcgcgctggccgtggaaaccgccgcc
agcggcatcacctgcaacgccgtcgcgccgggaaccgcgcccacgccggccatcgtcggc
cgcatcgccgagatcgcgcggcgcgacggcgtcgcgcaggaacaggccgaacgcgaatac
ctggccgccgcgcgccaacccaccggccgcttcgtcgccatggaaaacgtggcggccctg
gtcgccttcctgtgcagcgatgccggacgcgacatcacgggcgccaccctgcccatcgac
ggcggctggaccgcggcctag

DBGET integrated database retrieval system