KEGG   Bordetella parapertussis Bpp5: BN117_3255Help
Entry
BN117_3255        CDS       T02297                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bpar00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BN117_3255
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BN117_3255
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BN117_3255
Enzymes [BR:bpar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BN117_3255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3512126..3513226
Genome map
AA seq 366 aa AA seqDB search
MLMNPSLSRLRCLRCSHAVPPGDYPEGCPRCLAAGYPASLACEYEPADTQPMPLPVLAPI
TLGEGRTPCLDAPALAHAHGVAQVWLKCESGNPTGSHKDRMAAQLVSRAVLAGAKRLAAA
SSGNAGVALAAYGAAAGLRVDIAIAPTCPPRQRAAMEQFGARLHSFADSLARWPYVATLC
RDEGAFAGTNYLNPPVGTHPYGVEGYKPIAAELAAQCDNLPTDIIVPTARGDLLWGICLG
WQALLRRGAIARLPRLHAVEPYPRLAHALAAGDARGVWEQPTAQYSIAGGTVTLQSMQAL
ARSGGRAVDVADEQAARARAALGALGIAAELSSAAALAAVPALKAAGALDARSRVALILT
SDGRRD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgctgatgaacccctcgctgtcccgcctgcgctgcctgcgctgttcccacgccgtgccg
ccgggcgactatccggaaggctgcccgcgctgcctggcggccggctacccggcctcgctg
gcatgcgaatacgaaccggccgatacgcagccgatgccgctgccggtcctcgcgccgatc
acgctgggcgaaggccgcacgccctgcctcgacgcgccggcgctggcgcatgcgcacggg
gtggcgcaagtctggctgaaatgcgaaagcggcaacccgacgggcagccacaaggaccgc
atggctgcgcaactggtgtcgcgcgcggtgctggccggcgccaagcggctggcggccgcg
tccagcggcaacgccggcgtggcgctggcggcctacggggccgccgccggcctgcgggtg
gacatcgccattgcgcccacctgcccgccgcggcaacgcgccgccatggagcagttcggc
gcgcgcctgcacagcttcgccgacagcctggcgcgctggccctacgtggcgacgctatgc
cgcgacgagggcgcgttcgccggcaccaactatctcaacccgccggtcggcacccaccct
tacggcgtggagggctacaagccgatcgccgccgaactcgctgcccagtgcgacaacctg
cccaccgacatcatcgtgcccacggcccggggcgatctgctgtggggcatctgcctgggc
tggcaggcgctgttgcggcgcggcgcgatcgcgcggctgccgcgcctgcatgcggtggaa
ccctatccccgcctggcgcacgcgctggccgccggcgatgcgcgcggcgtgtgggaacag
ccgacggcgcagtattccatcgccggcggcaccgtgaccctgcaatcgatgcaggccctg
gcgcgcagcggcggacgggccgtggatgtcgcggacgagcaggccgcgcgggcccgcgcg
gcgctgggcgcgctgggcatcgccgccgagctgtcgtcggccgcggcgcttgccgccgtg
ccggcgctcaaggctgccggcgcgctggacgccaggtcgcgcgtggcgctgatcctgacc
tcggacgggcggcgcgactaa

DBGET integrated database retrieval system