KEGG   Bordetella parapertussis Bpp5: BN117_3255Help
Entry
BN117_3255        CDS       T02297                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bpar  Bordetella parapertussis Bpp5
Pathway
bpar00260  Glycine, serine and threonine metabolism
bpar00750  Vitamin B6 metabolism
bpar01100  Metabolic pathways
bpar01110  Biosynthesis of secondary metabolites
bpar01120  Microbial metabolism in diverse environments
bpar01230  Biosynthesis of amino acids
Module
bpar_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bpar00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BN117_3255
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BN117_3255
Enzymes [BR:bpar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BN117_3255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DFP
Motif
Other DBs
NCBI-GeneID: 13891292
NCBI-ProteinID: YP_006897065
UniProt: K0MGH6
Position
3512126..3513226
Genome map
AA seq 366 aa AA seqDB search
MLMNPSLSRLRCLRCSHAVPPGDYPEGCPRCLAAGYPASLACEYEPADTQPMPLPVLAPI
TLGEGRTPCLDAPALAHAHGVAQVWLKCESGNPTGSHKDRMAAQLVSRAVLAGAKRLAAA
SSGNAGVALAAYGAAAGLRVDIAIAPTCPPRQRAAMEQFGARLHSFADSLARWPYVATLC
RDEGAFAGTNYLNPPVGTHPYGVEGYKPIAAELAAQCDNLPTDIIVPTARGDLLWGICLG
WQALLRRGAIARLPRLHAVEPYPRLAHALAAGDARGVWEQPTAQYSIAGGTVTLQSMQAL
ARSGGRAVDVADEQAARARAALGALGIAAELSSAAALAAVPALKAAGALDARSRVALILT
SDGRRD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgctgatgaacccctcgctgtcccgcctgcgctgcctgcgctgttcccacgccgtgccg
ccgggcgactatccggaaggctgcccgcgctgcctggcggccggctacccggcctcgctg
gcatgcgaatacgaaccggccgatacgcagccgatgccgctgccggtcctcgcgccgatc
acgctgggcgaaggccgcacgccctgcctcgacgcgccggcgctggcgcatgcgcacggg
gtggcgcaagtctggctgaaatgcgaaagcggcaacccgacgggcagccacaaggaccgc
atggctgcgcaactggtgtcgcgcgcggtgctggccggcgccaagcggctggcggccgcg
tccagcggcaacgccggcgtggcgctggcggcctacggggccgccgccggcctgcgggtg
gacatcgccattgcgcccacctgcccgccgcggcaacgcgccgccatggagcagttcggc
gcgcgcctgcacagcttcgccgacagcctggcgcgctggccctacgtggcgacgctatgc
cgcgacgagggcgcgttcgccggcaccaactatctcaacccgccggtcggcacccaccct
tacggcgtggagggctacaagccgatcgccgccgaactcgctgcccagtgcgacaacctg
cccaccgacatcatcgtgcccacggcccggggcgatctgctgtggggcatctgcctgggc
tggcaggcgctgttgcggcgcggcgcgatcgcgcggctgccgcgcctgcatgcggtggaa
ccctatccccgcctggcgcacgcgctggccgccggcgatgcgcgcggcgtgtgggaacag
ccgacggcgcagtattccatcgccggcggcaccgtgaccctgcaatcgatgcaggccctg
gcgcgcagcggcggacgggccgtggatgtcgcggacgagcaggccgcgcgggcccgcgcg
gcgctgggcgcgctgggcatcgccgccgagctgtcgtcggccgcggcgcttgccgccgtg
ccggcgctcaaggctgccggcgcgctggacgccaggtcgcgcgtggcgctgatcctgacc
tcggacgggcggcgcgactaa

DBGET integrated database retrieval system