KEGG   Bordetella pertussis Tohama I: BP0229Help
Entry
BP0229            CDS       T00139                                 

Definition
(RefSeq) beta-D-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bpe  Bordetella pertussis Tohama I
Pathway
bpe00072  Synthesis and degradation of ketone bodies
bpe00650  Butanoate metabolism
bpe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpe00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BP0229
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BP0229
Enzymes [BR:bpe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BP0229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase RmlD_sub_bind DFP
Motif
Other DBs
NCBI-GeneID: 2664750
NCBI-ProteinID: NP_879117
UniProt: Q7W0B7
Position
complement(236528..237325)
Genome map
AA seq 265 aa AA seqDB search
MNPARPLHGRCALITGAEAGLGLAIADTLARSGADIVMHCLQANESARQAQAALAREHGV
RVLLLQADLRDVDQIEAMAAQALAELPRLDILVNNAVVRHFEPAHELPRAHWDESLAVNL
SAAFHLARLALPGMLAQGWGRIINLSSVYGAGAAANRVGYVTTKTALLGLTRALAVETAA
SGITSNAVAPGTAPTPAIVGRITEIARRDGVAQEQAEREYLAARQPTGRFVAMENVAALV
AFLCSDAGRDITGATLPIDGGWTAA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaacccggcccgcccgctacacgggcgctgcgccctgatcaccggcgccgaggccgga
ctggggctggccatcgccgatacgctggcccgttccggcgccgacatcgtgatgcactgc
ctgcaggccaacgaaagcgcccgccaggcgcaagccgccctggcgcgcgagcacggcgtg
cgggtgctgctgctgcaggccgacctgcgggacgtggaccagatcgaggccatggcggcc
caggcgctggccgagctgccgcgcctggacatcctggtcaacaacgccgtggtgcgccat
ttcgagccggcccatgaactgccgcgcgcccactgggacgagtcgctggccgtcaacctg
tcggcggcgttccacctcgcccgcctggcgctgccgggcatgctggcgcagggctggggc
cgcatcatcaatctgtcgtcggtctatggcgcgggagccgcggccaaccgggtcggctac
gtcaccaccaagaccgccctgctgggactgacccgcgcgctggccgtggaaaccgccgcc
agcggcatcaccagcaacgccgtcgcgccgggaaccgcgcccacgccggccatcgtcggc
cgcatcaccgagatcgcgcggcgcgacggcgtcgcgcaggaacaggccgaacgcgaatac
ctggccgcgcgccaacccaccggccgcttcgtcgccatggaaaacgtggcggccctggtc
gccttcctgtgcagcgatgccggacgcgacatcacgggcgccaccctgcccatcgacggc
ggctggaccgcggcctag

DBGET integrated database retrieval system