KEGG   Bacillus pseudofirmus: BpOF4_04885Help
Entry
BpOF4_04885       CDS       T01165                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bpf  Bacillus pseudofirmus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bpf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BpOF4_04885 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BpOF4_04885 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BpOF4_04885 (thrC)
Enzymes [BR:bpf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BpOF4_04885 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3234622..3235686)
Genome map
AA seq 354 aa AA seqDB search
MSKWNGLLHEYKEFLPVNDKTPMLTLKEGNTPLIPLENLSKEWGVELYVKVEGANPTGSF
KDRGMVMAVAKAKEEGSDTIICASTGNTSAAAAAYGARLGMRCIVVIPEGKIALGKLAQA
VMYGAEVIEIKGNFDHALEIVRAISETEPITLVNSVNPYRIEGQKTAAFEVCDALGQAPD
VLAIPVGNAGNITAYWKGFNEYHEKKGTGLPEMRGFEAEGAAAIVRDEVIEEPETVATAI
RIGNPASWSQAVTAANDSNGAIDYVTDEEILEAYQLLAKREGVFAEPASCASLAGVKKQL
ASGELKKGSKIVCVLTGNGLKDPSTAMDTVAVKPTVLPNEKDAFLSHIKGGVKL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaatggaatgggttacttcatgaatataaagagtttttaccggtaaatgataaa
acaccaatgttaacgttaaaagaaggaaatactcctttgatccctcttgaaaatctgtca
aaggaatggggagtggagctatacgttaaggtagaaggggcaaacccgactggttctttt
aaagatcgcggaatggtcatggctgttgcgaaagcaaaggaagaaggcagtgacacaatt
atttgtgcttcaacaggaaatacgtcagcagcggctgcggcttacggtgcgcgtcttggc
atgagatgtattgtcgttattcctgaaggaaaaatcgctcttggtaaattagcacaagct
gtcatgtacggagctgaagtcatcgagattaaaggaaactttgatcatgcgcttgaaatt
gttcgtgcgatcagtgaaacggagccgattacgttagtgaactcggtaaacccttatcga
attgaagggcagaaaacggctgcatttgaagtgtgtgatgcacttgggcaagcgccggat
gtacttgcaatcccagtaggaaatgccggaaatattacagcgtactggaaagggtttaac
gaataccacgaaaagaaaggtacgggccttcctgaaatgcgtgggtttgaggcagaggga
gcagccgcgattgttcgtgatgaagtaattgaagagcctgaaacagttgctacagctatc
cgtatcggaaatcctgccagctggtctcaagcggtaactgcagctaatgattcaaatgga
gccattgattacgtaacagatgaagaaattttagaggcgtatcagcttcttgctaagcgt
gaaggggtatttgctgaaccggcatcttgcgcttcattagcaggtgtgaaaaagcagctt
gcttcaggtgaattaaagaaaggctcaaagattgtatgtgtgttaacaggaaacggctta
aaagatccaagcacagcaatggatacagtagctgttaaaccaacggttcttcctaatgaa
aaggatgcattcttatctcatattaaaggaggggttaagctgtga

DBGET integrated database retrieval system