KEGG   Burkholderia phymatum: Bphy_2701Help
Entry
Bphy_2701         CDS       T00704                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bph  Burkholderia phymatum
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bph01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:bph00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3054545..3055330
Genome map
AA seq 261 aa AA seqDB search
MSDILDRIIDVKRQEVRAAQQSAPLEELRLQASTRDLRDFVGAIRAKHEAGLAAVIAEVK
KASPSKGVLREHFVPADIARSYANHGAACLSVLTDVQFFKGSAQYLEEARAACQLPVLRK
DFIVDPYQILEARAMGADAILLIVAALETSQMQDLEAYAHSLGLAVLVEVHDKDELVEAL
TLKTPLIGVNNRNLRTFETSIDTTLGLLDMMPDDRIVVTESGILSRTDVERMRAMDVNTF
LVGEAFMRADEPGVELARMFF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatattctcgaccgcatcatcgacgtcaagcgccaagaagtgcgcgccgcgcag
caaagcgcgccgctcgaagaactgcgtctccaggcatccacacgcgatctgcgcgatttc
gtcggcgcaatccgcgccaagcacgaggccggtctcgcggccgtgatcgccgaggtcaag
aaggcgagcccgtcgaaaggcgtgctgcgcgagcacttcgtccccgccgatatcgcgcgt
tcgtatgccaatcatggcgcagcatgtctgtccgtgctgaccgacgtgcagttcttcaag
ggcagcgcacagtatctggaagaagcgcgcgccgcctgccagttgcccgtgctgcgcaag
gacttcatcgtcgatccgtatcagatcctcgaagcgcgcgcgatgggcgccgacgcgatc
ctgctgatcgtcgcagcactcgaaacctcgcagatgcaggacctcgaagcgtacgcgcac
tcgctcggtctcgcggtgctcgtcgaagtgcacgacaaggacgaactggtcgaagcgctg
acgctgaagacgccgctgatcggcgtgaacaaccgcaatctgcgcacgttcgaaacttcg
atcgacacgacgctcggcctgctcgacatgatgccggacgaccgcatcgtcgtgaccgaa
tccggcattctgtcgcgcaccgacgtcgagcggatgcgcgcgatggacgtgaacacgttc
ctcgtcggcgaggcgttcatgcgtgccgacgagccgggcgtggaacttgcgcggatgttc
ttctga

DBGET integrated database retrieval system