KEGG   Blattabacterium BPLAN (Periplaneta americana): BPLAN_140Help
Entry
BPLAN_140         CDS       T00996                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bpi  Blattabacterium BPLAN (Periplaneta americana)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bpi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BPLAN_140 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BPLAN_140 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BPLAN_140 (thrC)
Enzymes [BR:bpi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BPLAN_140 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
149681..150991
Genome map
AA seq 436 aa AA seqDB search
MLYYSLEDHKNLVSFEKAVLRGLATDGGLYFPKNIPILKRKFMENLQKYDISTIAMEIIQ
PYIGESISEESIFRIIQKTLNFPFPLQRIHDNIYVLELFHGPTLAFKDVGAKFMAGCLSH
FYKKIGKLVTVLVATSGDTGGAVAKGFHNVSGIEVIILYPYKGVSLLQEKQMTCLGGNIL
AIEIKGNFDDCQSMVKKAFLDKKIRDKYLLTSANSINIARWLPQMFYYFLAYRQIIEENR
KLIFSVPSGNFGNICAGMMAEKMGLPIKYFIASTNINDTIPRFLKTEKYHPLPVKKTISN
AMDISHPSNFSRIWHLYKESIVKLRKKLSSYQFTDEETLAIIEMVWQEHKYMLDPHGAIG
YLGLRQYLQEVKDPLATAVFLETAHPIKFLDHMPYSLREEILIPKKLEVFLNSEKSEKKI
SMSNNYDMFQNWLINR
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgttatattacagtttagaagatcataaaaatctagtttcttttgaaaaggccgtttta
agaggtttagcaacagatggagggttatattttccgaaaaatattcctattctaaaacgt
aaattcatggaaaatctccaaaaatatgatatatccactattgctatggagattatccaa
ccatatataggagaatctatttctgaagaatctatcttccgcattattcagaaaactttg
aattttccttttccattacaaagaattcacgacaatatatacgtgttagagctttttcat
gggcctactttagcctttaaagacgtaggggctaaattcatggccggatgtttaagtcat
ttttacaaaaaaataggaaaattagttactgttttagtagccacttctggagatactgga
ggggctgttgccaaaggatttcataatgtttctggaatagaagttattatattatatccc
tataaaggggtaagcttattacaggaaaagcaaatgacttgtttaggggggaatatacta
gctatagaaataaaggggaattttgatgattgtcaatccatggttaaaaaagctttctta
gacaagaaaatacgagataaatatctactaacttctgctaattctattaacatagcaaga
tggcttcctcaaatgttttattattttttagcttatagacaaataatagaagaaaataga
aaattgattttttcagttccaagtggaaattttggaaatatttgtgcgggaatgatggct
gaaaaaatgggattgcctattaagtattttatagcctccacaaatattaatgacaccatt
cctagatttttaaaaacggaaaaatatcatcctcttccagtaaaaaaaacgatatcaaat
gccatggacatatcccatccgagtaatttttctcgaatatggcatttatataaagaaagc
atagtgaaattacgaaaaaaattgtcctcttatcaatttacagatgaagaaactttagcc
attatagaaatggtatggcaagaacataaatatatgctagatccccatggagctattggt
tatttaggacttagacaatacctacaagaagttaaagatcctttagctacagctgttttt
ttagaaacagctcatcctattaaatttttagatcatatgccatattctttgcgagaagaa
attcttattcctaaaaaattagaagtttttttgaattcagaaaaaagtgaaaaaaaaata
tcgatgtccaacaattacgatatgtttcaaaattggttaattaatagatag

DBGET integrated database retrieval system