KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_0725Help
Entry
BURPS1710b_0725   CDS       T00289                                 

Gene name
bcc1
Definition
chitinase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bpm00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:bpm00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(737872..740442)
Genome map
AA seq 856 aa AA seqDB search
MKDPIAATYFHGVVSPFFCQGTPMNRISHSLCAALLAAATLLPTASRAQLPARPTAGAAA
PATAAPVRPASTPAELAARLANGLAVRVAVDNNHAASAGVPCADLGADWASCATGRLILQ
NRGHSPLTDGGWKLYLHSIRRLLRIDRPGFTLRHLTGDLYELTPQPGTVRLAQGERIELP
FVAEYWLRRYSDVIPRPYVVVDGAAPAVLRYDDTDDELRYVETLPADAQNNSPGNAPPAA
AQPVANRALPSVKRQRALPGALDLRGVELTLPELPSAQVAALRERAGTLGLDGARVPVWG
VVAPRRLPADIAVPGGYRLAIGPRGAFIEGADRAGLYYGVQTLFSLVPAGGATVPAMLIE
DAPRFTHRGMHVDLARNFKPPATLRRLIDQMSAYKLNRLHLHLSDDEGWRIEIPGLPELT
DVGARRCHDPSETRCLLPQLGSGPDDRSGGGYLTRDDYVALLRYAAERFVEVIPEIDMPA
HSRAAVVSMEARYRRLHAAGREREANAYRLLDAQDTSNLLTVQFYDRRSDLNPCMPGALN
FASKVIREIASMHADAQAPLRIWHFGGDEAKNILLGAGFQPLDGADPGKGRVDLAAQDKP
WARSPACTALLRRGEIKSIDELPTRFAKQVSAIVNANGIGTMAAWQDGIKHASGPREFST
RHVMVSLWDTIFWGASDSARDLSAKGYRTVLALPDYLYFDFPYTRNPRERGYYWGSQATD
EYKVFSLAPENLPQNAEVFGDRDGNPFEVTSAGAAPSIEGIQGQAWGEVMRNGQLLEYMV
YPRLLALAERAWHKADWELPYAAGVRYKLGDTHHVDTAALERDWAGFATVLKQRELPKLE
RAGIGYRKPTFTLTGE
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagacccgatcgcagcgacgtatttccacggcgtcgtatcgccgtttttttgccaa
ggaacgcccatgaaccgaatctcgcattccctgtgcgccgcgctattggccgccgcgacg
ctgttgcccacggcctcgcgcgcgcaactgcccgcgcgccccacggccggcgcggccgcg
cccgcgacggccgcgcccgtgcggcccgcgtccacgccggccgagctcgccgcgcggctc
gccaacggcctcgcggtgcgcgtggccgtcgacaacaatcacgcggcatcggccggcgtg
ccgtgcgccgacctcggcgcggactgggcgagctgcgcgacgggccgcctgatcctgcag
aatcgcggccactcgcccctcaccgacggcggctggaagctctatctgcacagcatccgc
cggctgctccgaatcgaccgccccggcttcacgctgcgccatctgacgggcgatctgtac
gagctgacgccgcagcccggcacggtaaggctcgcgcagggcgagcgcatcgagctgccg
ttcgtcgccgaatactggctgcgccgctacagcgacgtgatcccgcgcccgtacgtggtc
gtcgacggcgcggcgcccgcggtgctgcgctacgacgataccgacgacgagctgcgctac
gtcgaaacgctgcccgccgacgcgcagaacaactcgcccggcaatgcgccgcccgccgcc
gcgcagccggtggcgaaccgcgcgctgccgagcgtgaagcggcagcgcgcgctgcccggc
gcgctcgatctgcgcggcgtcgagctgacgctgccggagctgccgtccgcgcaggtcgcg
gcgctgcgcgaacgcgcgggcacgctcggcctggacggcgcgcgcgtgccggtgtggggc
gtcgtcgcgccgcgccggctgcccgccgacatcgcggtgccgggcggctaccggctcgcg
atcggcccgcgcggcgcgttcatcgagggggccgatcgcgcgggcctctactacggcgtg
cagacgctcttctcgctcgtgccggccggcggcgcgacggtgcccgcgatgctgatcgaa
gacgcgccgcgcttcacgcaccgcgggatgcacgtcgatctcgcgcgcaacttcaagccg
cccgccacgctgcgccggctgatcgaccagatgagcgcgtacaagctcaaccggctgcat
ctgcacctgtccgacgacgagggctggcgcatcgagattcccggcctgcccgagctgacc
gacgtcggcgcgcgccgctgccacgacccgagcgagacgcgctgcctgctgccgcagctc
ggctcggggcccgacgatcgttcgggcggcggctacctgacgcgcgacgactacgtcgcg
ctgctgcgctacgcggccgagcgcttcgtcgaagtgatccccgagatcgacatgcccgcg
cactcgcgcgcggccgtcgtatcgatggaggcgcgctatcgccgcctgcacgcggcgggc
cgcgagcgggaagcgaacgcgtatcggctgctcgatgcgcaggacacgtcgaacctgctg
accgtgcagttctacgaccggcgcagcgatctgaacccgtgcatgccgggcgcgctgaac
ttcgcgtcgaaggtgatccgcgagatcgcgtcgatgcacgcggacgcgcaagcgccgctg
cggatctggcacttcggcggcgacgaggcgaagaacatcctgctcggcgcgggcttccag
ccgctcgacggcgccgatcccggcaagggccgcgtcgatctcgccgcgcaggacaagccg
tgggcgcgctcgcccgcctgtacggcgctgcttcggcgcggcgagatcaaatcgatcgac
gaattgccgacgcgcttcgcgaagcaggtcagcgcgatcgtgaacgcgaacggaatcggc
acgatggccgcgtggcaggacggcatcaagcacgcgagcgggccgcgggagttcagcacg
cggcacgtgatggtgtcgctgtgggacaccatcttctggggcgcgtccgacagcgcgcgc
gatctgagcgcgaagggctaccggaccgtgctcgcgctgcccgattacctgtacttcgat
ttcccgtacacgcgcaatccgcgcgagcgcggctattactggggctcgcaggcgacggac
gagtacaaggtgttctcgctcgcgccggagaacctgccgcagaacgccgaggtgttcggc
gatcgcgacggcaacccgttcgaggtgacgagcgcgggcgcggcgccgagcatcgagggc
atccaggggcaggcgtggggcgaggtgatgcgcaacgggcaactgctcgaatacatggtg
tatccgcgccttctcgcgctcgccgagcgcgcgtggcacaaggccgactgggaactgccc
tacgcggccggcgtgcgctacaagctcggcgacacgcatcacgtcgacacggccgcgctc
gagcgcgactgggcgggcttcgcgacggtgctcaagcagcgcgaactgccgaagctcgaa
cgtgcgggcatcgggtatcgcaagccgacgtttacgctgacgggcgaatga

DBGET integrated database retrieval system