KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_3551Help
Entry
BURPS1710b_3551   CDS       T00289                                 

Gene name
ftsI
Definition
penicillin-binding protein (EC:2.4.1.129)
Orthology
K03587  
cell division protein FtsI (penicillin-binding protein 3)
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
beta-Lactam resistance
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BURPS1710b_3551 (ftsI)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BURPS1710b_3551 (ftsI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3871160..3873004)
Genome map
AA seq 614 aa AA seqDB search
MKPASKRTQGVKFASSPVLSVHLPMWRSKLVVFMLFIAFVALAMRAFWIQGPGNAFYQKQ
GESRYQRTLELPATRGKILDRNGLVLATSLPVRAIWAIPADVPDDLGADKLDALGKLLGM
TTKELKAKLSEDKTFVYVKRQVPLDVAEQVAKLDIPGVYQRGEYKRFYPEGEITAHLIGF
TNVEDEGQEGVELADQKLLVGTPGSRHVIKDRVGHIVEDVDAQVPPHNGADVGLSIDSKI
QYITYTNLKAAVEKFHAKAGAAMVIDVQTGEVLSLVNYPTYNPNDRSHLTGEQLRNRVLT
DVFEPGSIMKPFTVSLALDLHRVTPNTLVETGNGHFVLDGAPITDDSGFGTLTVGGVIQK
SSNIGATKIAMTMKPEEMWNMYTGIGLGQAPKVGFPGAAAGRLRPWKNWRRIEQATMSYG
YGLSVSLFQLARAYTAIAHDGELMPVTIFKTNDAQPPTGPRVFSPTTAREVRTMLESVVS
PQGTSPNAAVPGYRVGGKSGTAYKQVGRGYDHKKYRASFVGMAPMPNPRIVVAVSVDEPT
TGGHFGGQVSGPVFSAIVGDTLRALNVPPNMPVKQLVVSDDATNAAAAQKLAANAPAKRL
IVSSTTHNRPGVVR
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccgcttcgaagcgcacgcaaggcgtgaagttcgcatcgagcccggtgctgtcg
gttcatctgccgatgtggcgctcgaagcttgtcgtgttcatgctgttcatcgctttcgtc
gcgctcgcgatgcgcgcgttctggatccaggggccgggcaacgcgttctatcagaaacag
ggcgaaagccgctatcagcgcacgctcgagttgccggcgacgcgcggcaagatcctcgat
cgcaacggcctcgtgctcgcgacgagcctgccggtgcgcgcgatctgggcgattccggcc
gacgtgcccgacgacctcggcgcggacaagctcgacgcgctcggcaagctgctcgggatg
acgacgaaggagctgaaggcgaagctctcggaagacaagacgttcgtctacgtgaagcgc
caggtgccgctcgacgtcgccgagcaggtcgcgaagctcgacattcccggcgtctatcag
cgcggcgaatacaagcgcttctacccggaaggcgagatcaccgcgcacctgatcggtttc
acgaacgtcgaggacgaggggcaggagggcgtcgagctcgccgaccagaagctgctcgtc
ggcacgccgggcagccgccacgtgatcaaggaccgcgtcgggcacatcgtcgaggacgtc
gatgcgcaggtgccgccgcacaacggcgccgacgtcggcctgtcgatcgacagcaagatc
cagtacatcacgtatacgaacctgaaggcggccgtcgagaaattccacgcgaaggcgggc
gcggcgatggtgatcgacgtgcagacgggcgaggtgctgtcgctcgtcaattatccgacg
tataacccgaacgaccgctcgcacctgacgggcgagcagttgcgcaaccgcgtgctgacc
gacgtgttcgagccgggctcgatcatgaagccgttcacggtctcgctcgcgctcgatctg
catcgcgtgacgccgaacacgctcgtcgagacgggcaatggccatttcgtgctcgacggc
gcgccgatcaccgacgattcgggcttcggcacgctgaccgtcggcggcgtgatccagaaa
tcgagcaacatcggcgcgacgaagatcgcgatgacgatgaagcccgaggaaatgtggaat
atgtatacaggcatcgggctcggacaggcgccgaaggtcggctttcccggcgcggcggcg
ggccgcctgcgcccgtggaagaactggcggcgcatcgagcaggcgacgatgtcgtacggc
tacggcctgtcggtgtcgctgttccagctcgcgcgcgcatacaccgcgatcgcgcacgac
ggcgaactgatgcccgtgacgattttcaagacgaacgacgcgcaacccccgacgggcccg
cgcgtcttctcgccgacgacggcccgcgaagtgcgcacgatgctcgaatccgtcgtgtcg
ccgcagggtacgtcaccgaatgcggcggtgcccggctatcgcgtcggcggcaagagcggt
accgcttacaagcaggtcggccgcggctatgatcacaagaagtatcgcgcgtcgttcgtc
gggatggcgccgatgccgaacccgcgcatcgtcgtcgccgtgtcggtcgacgaaccgacg
acgggcggtcacttcggcggccaggtgtcgggccccgtattctccgcgatcgtcggcgat
acgctgcgcgcgctgaacgtgccgcccaacatgccggtcaagcagctcgtcgtgtcggat
gatgcgacgaacgccgccgccgcgcaaaagctggccgcgaatgcgccggcgaaacgcctg
atcgtgtcgagcacgacacacaaccgtcctggagtagttcgatga

  All links  
No link information was found.   
DBGET integrated database retrieval system