KEGG   Burkholderia pseudomallei MSHR346: GBP346_A3388Help
Entry
GBP346_A3388      CDS       T00894                                 

Gene name
galU_2
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GBP346_A3388 (galU_2)
   00052 Galactose metabolism
    GBP346_A3388 (galU_2)
   00500 Starch and sucrose metabolism
    GBP346_A3388 (galU_2)
   00520 Amino sugar and nucleotide sugar metabolism
    GBP346_A3388 (galU_2)
Enzymes [BR:bpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     GBP346_A3388 (galU_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:3266048..3267022
Genome map
AA seq 324 aa AA seqDB search
MCVAGIASPRSRAAGPHANVQRLRWKVRRPMLKVTKAVFPVAGLGTRFLPATKASPKEML
PIVDKPLIQYAVEEAIAAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEKLLTLV
RGIKPRHVDCFYVRQAEALGLGHAVLCAQKLVGDSPFAVVLADDLLDGRPPVLRQMIDVF
NHYHTSVIGVEQIAPQDSKSYGVIDGKRWEDNLFKLSGIVEKPEPAAAPSNFGVVGRYVL
TPRIFDHLRALKPGAGGELQLTDALQSLLKDEQVLAHRYDGLRFDCGSKIGYLKATVEFA
LRHPEVAPEFERYLSERFPELVAA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcgtcgccggtatcgcctcccctcgatcacgcgccgccggcccgcacgcaaacgtt
caacgtcttcgatggaaggttcgacgcccgatgctgaaagtcacaaaagccgtattcccc
gtcgccggcctcggcacccgctttttgcccgcgacgaaagcgagtccgaaggaaatgctg
ccgatcgtcgacaagcccctgattcagtatgcggtcgaggaagcgatcgccgcgggcatc
accgagatgatcttcgtcacgggccgcagcaagcgcgccatcgaggatcatttcgacaaa
tcgtatgagatcgaggcggagctcgaagcccgcggcaaggaaaagctgctgacgctcgtg
cgcggcatcaagccgcggcatgtcgattgtttctacgtgcgccaggccgaagcgctcggg
ctcggtcacgcggtgctgtgcgcgcagaagctcgtcggcgacagcccgttcgccgtcgtc
ctcgcggacgacctgctcgacgggcggccgcccgtgctgcggcagatgatcgacgtgttc
aatcactatcacacgtccgtcatcggcgtcgagcagatcgccccgcaggattcgaagtcg
tacggcgtgatcgacggcaagcgctgggaagacaatctcttcaagctgtcgggcatcgtc
gagaagcccgagccggccgccgcgccgtcgaatttcggcgtcgtcggccgctacgtgctc
acgccgcgcatcttcgaccatctgcgcgcgctcaagcccggggcgggcggcgaactgcaa
ttgaccgacgcgctgcaatcgctgttgaaggacgagcaagtgctcgcgcatcgctacgac
ggcctgcgcttcgattgcggcagcaagatcggctatttgaaggcgacggtcgagttcgcg
ctgcgccacccggaagtcgcccccgaattcgaacggtatctgagcgagcgctttccggag
ctcgtggccgcatga

DBGET integrated database retrieval system