KEGG   Burkholderia pseudomallei MSHR346: GBP346_A3388Help
Entry
GBP346_A3388      CDS       T00894                                 

Gene name
galU_2
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bpr  Burkholderia pseudomallei MSHR346
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bpr00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bpr00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bpr00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bpr00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:3266048..3267022
Genome map
AA seq 324 aa AA seqDB search
MCVAGIASPRSRAAGPHANVQRLRWKVRRPMLKVTKAVFPVAGLGTRFLPATKASPKEML
PIVDKPLIQYAVEEAIAAGITEMIFVTGRSKRAIEDHFDKSYEIEAELEARGKEKLLTLV
RGIKPRHVDCFYVRQAEALGLGHAVLCAQKLVGDSPFAVVLADDLLDGRPPVLRQMIDVF
NHYHTSVIGVEQIAPQDSKSYGVIDGKRWEDNLFKLSGIVEKPEPAAAPSNFGVVGRYVL
TPRIFDHLRALKPGAGGELQLTDALQSLLKDEQVLAHRYDGLRFDCGSKIGYLKATVEFA
LRHPEVAPEFERYLSERFPELVAA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcgtcgccggtatcgcctcccctcgatcacgcgccgccggcccgcacgcaaacgtt
caacgtcttcgatggaaggttcgacgcccgatgctgaaagtcacaaaagccgtattcccc
gtcgccggcctcggcacccgctttttgcccgcgacgaaagcgagtccgaaggaaatgctg
ccgatcgtcgacaagcccctgattcagtatgcggtcgaggaagcgatcgccgcgggcatc
accgagatgatcttcgtcacgggccgcagcaagcgcgccatcgaggatcatttcgacaaa
tcgtatgagatcgaggcggagctcgaagcccgcggcaaggaaaagctgctgacgctcgtg
cgcggcatcaagccgcggcatgtcgattgtttctacgtgcgccaggccgaagcgctcggg
ctcggtcacgcggtgctgtgcgcgcagaagctcgtcggcgacagcccgttcgccgtcgtc
ctcgcggacgacctgctcgacgggcggccgcccgtgctgcggcagatgatcgacgtgttc
aatcactatcacacgtccgtcatcggcgtcgagcagatcgccccgcaggattcgaagtcg
tacggcgtgatcgacggcaagcgctgggaagacaatctcttcaagctgtcgggcatcgtc
gagaagcccgagccggccgccgcgccgtcgaatttcggcgtcgtcggccgctacgtgctc
acgccgcgcatcttcgaccatctgcgcgcgctcaagcccggggcgggcggcgaactgcaa
ttgaccgacgcgctgcaatcgctgttgaaggacgagcaagtgctcgcgcatcgctacgac
ggcctgcgcttcgattgcggcagcaagatcggctatttgaaggcgacggtcgagttcgcg
ctgcgccacccggaagtcgcccccgaattcgaacggtatctgagcgagcgctttccggag
ctcgtggccgcatga

DBGET integrated database retrieval system