KEGG   Butyrate-producing bacterium SS3/4: CK3_08060Help
Entry
CK3_08060         CDS       T02611                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bprs  Butyrate-producing bacterium SS3/4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bprs00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(815386..817323)
Genome map
AA seq 645 aa AA seqDB search
MTRTKKTTAPAKTKEIGLGFITELDRYLFGQGTHYKIFEKLGAHPKTYKGKAGMYFAVWA
PHAKAVGVVGDFNGWDPDAAPMSPLADSGIYEAFIPGVGLGELYKFAITTQEGMILFKAD
PYAVHAEFRPGTASITEDINGFKWDDAAWMETRKKADPVKSPMAIYEVHLGSWRKKDRPQ
KEGYYTYMEAAHELADYVKKMGYTHVELMGIAEHPYDGSWGYQVTGYYAPTSRYGTPKEF
MYFVNYLHKKGIGIILDWVPAHFPKDAHGLADFDGQPLYEYADPRKGEHPDWGTKVFDYS
KNEVKNFLIANALYWVENFHVDGLRVDAVASMLYLDYGRSDGNWVPNKYGENKNLEAIEF
FRHLNSVLTGHLTGAMMIAEESTAWPGVTKPPEEGGLGFTFKWNMGWMHDFLEYMKLDPY
FRKFNHNKMTFGITYATSENYILTLSHDEVVHLKCSMINKMPGLNGDKFANLKAGYTFMM
GHPGKKLLFMGQDFGQYHEWDEKVSLDWYLADEPLHKDLQKYYSDLLHVYQKYPALWQLD
SDWNGFQWINANDGDRSIFSFIRRDETGKKNLLFVINFTPVARDDYRVGVPKSGTYSLIL
DSEHGLYKRGEHAFSARSKKSECDGQPYSFAYPLPAYGTAIFKFN
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgacaagaacaaagaaaaccacagctcctgccaaaacaaaggagatcggtctcggtttc
atcaccgaactggaccggtatctcttcggacaggggacccattataaaatcttcgaaaaa
cttggtgcacatccaaagacttataaggggaaagccggaatgtattttgccgtctgggct
ccccacgcaaaggccgtcggtgttgtgggcgatttcaacggctgggatccggacgccgca
ccgatgtccccgttagctgactccggaatctacgaggcgtttattcccggcgtcggtctc
ggagaactctataaattcgcgatcaccacacaggagggaatgatcctgttcaaggctgac
ccgtatgcggtccatgcggaattccgtccgggaaccgcttctatcacagaagacattaac
ggcttcaaatgggatgacgcagcctggatggagacaagaaaaaaagctgatcctgtgaaa
tccccgatggcaatctacgaggtccatctcggttcctggcgcaagaaagaccgtccacag
aaggaaggttactatacatatatggaagctgcccacgagctggctgattatgtaaagaag
atgggctacacccacgtagaactcatgggaattgcggaacatccatacgacggttcctgg
ggctatcaggttaccggctactacgcgccgacttcccgttacggcactccaaaagagttc
atgtactttgtgaactacctccacaaaaaagggatcggtatcatccttgactgggttccg
gcccacttcccgaaggatgcccacggacttgccgacttcgacggtcagccgctctatgaa
tacgcagatccgcgaaagggcgagcacccggactggggcacaaaggtcttcgattacagc
aaaaatgaggtcaaaaacttcttgatcgctaacgccctctactgggtagagaacttccat
gttgacggtctccgcgtagatgccgtcgcgtccatgctgtacctggattacggccgcagc
gatggaaactgggttccgaataagtacggcgagaacaagaacctcgaagccatcgagttc
ttccgccatttgaacagtgtcctcaccggacatctcaccggtgccatgatgatcgctgag
gagtccaccgcatggccgggtgtcacaaaaccgccggaagagggaggtctcggcttcacc
ttcaagtggaacatgggctggatgcatgattttctggagtacatgaaactggatccatat
ttcagaaaattcaaccacaataagatgacattcggcatcacctacgccaccagtgagaat
tatatcctgacgctgtcccacgacgaggtcgttcacctgaagtgttccatgatcaacaag
atgccgggcttaaatggtgacaagtttgcgaatctgaaagcaggatacaccttcatgatg
gggcatccgggaaagaagctcctgtttatgggccaggatttcggtcagtatcatgagtgg
gatgagaaggtttccctcgactggtatctcgccgacgagccgcttcacaaagacctgcag
aaatattacagcgacctgctgcatgtataccagaaatatccggcactgtggcagctggat
tccgactggaacggtttccagtggatcaacgccaacgatggtgaccgcagcatcttcagt
tttatccgccgtgatgagacgggcaagaagaatctcttattcgtcattaactttacaccg
gttgcacgcgacgattaccgggtaggcgttccgaagtccggaacctactccctgatcctg
gattccgagcatgggctctacaagcgcggcgagcatgcattctccgcccgctccaagaaa
agcgagtgcgatggccagccatactcctttgcgtatccgctgccggcgtacgggactgca
atctttaagttcaactaa

DBGET integrated database retrieval system