KEGG   Burkholderia pseudomallei K96243: BPSL2769Help
Entry
BPSL2769          CDS       T00203                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bps  Burkholderia pseudomallei K96243
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bps00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BPSL2769
   00052 Galactose metabolism
    BPSL2769
   00500 Starch and sucrose metabolism
    BPSL2769
   00520 Amino sugar and nucleotide sugar metabolism
    BPSL2769
Enzymes [BR:bps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BPSL2769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1:3306699..3307583
Genome map
AA seq 294 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAIAAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKEKLLTLVRGIKPRHVDCFYVRQAEALGLGHAVLCAQK
LVGDSPFAVVLADDLLDGRPPVLRQMIDVFNHYHTSVIGVEQIAPQDSKSYGVIDGKRWE
DNLFKLSGIVEKPEPAAAPSNFGVVGRYVLTPRIFDHLRALKPGAGGELQLTDALQSLLK
DEQVLAHRYDGLRFDCGSKIGYLKATVEFALRHPEVAPEFERYLSERFPELVAA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaagtcacaaaagccgtattccccgtcgccggcctcggcacccgctttttgccc
gcgacgaaagcgagtccgaaggaaatgctgccgatcgtcgacaagcccctgattcagtat
gcggtcgaggaagcgatcgccgcgggcatcaccgagatgatcttcgtcacgggccgcagc
aagcgcgccatcgaggaccatttcgacaaatcgtatgagatcgaggcggagctcgaagcc
cgcggcaaggaaaagctgctgacgctcgtgcgcggcatcaagccgcggcatgtcgattgt
ttctacgtgcgccaggccgaagcgctcgggctcggtcacgcggtgctgtgcgcgcagaag
ctcgtcggcgacagcccgttcgccgtcgtcctcgcggacgacctgctcgacgggcggccg
cccgtgctgcgacagatgatcgacgtgttcaatcactatcacacgtccgtcatcggcgtc
gagcagatcgccccgcaggattcgaagtcgtacggcgtgatcgacggcaagcgctgggaa
gacaatctcttcaagctgtcgggcatcgtcgagaagcccgagccggccgccgcgccgtcg
aatttcggcgtcgtcggccgctacgtgctcacgccgcgcatcttcgaccatctgcgtgcg
ctcaagcccggggcgggcggcgaactgcaattgaccgacgcgctgcaatcgctgttgaag
gacgagcaagtgctcgcgcatcgctacgacggcctgcgcttcgattgcggcagcaagatc
ggctatttgaaggcgacggtcgagttcgcgctgcgccacccggaagtcgcccccgaattc
gaacggtatctgagcgagcgctttccggagctcgtggccgcatga

DBGET integrated database retrieval system