KEGG   Paraburkholderia phytofirmans: Bphyt_2490Help
Entry
Bphyt_2490        CDS       T00765                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bpy  Paraburkholderia phytofirmans
Pathway
bpy00620  Pyruvate metabolism
bpy00630  Glyoxylate and dicarboxylate metabolism
bpy01100  Metabolic pathways
bpy01110  Biosynthesis of secondary metabolites
bpy01120  Microbial metabolism in diverse environments
bpy01200  Carbon metabolism
Module
bpy_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bphyt_2490
   00630 Glyoxylate and dicarboxylate metabolism
    Bphyt_2490
Enzymes [BR:bpy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bphyt_2490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ACD16886
JGI: Bphyt2490
UniProt: B2SXN0
Position
1:2810278..2811888
Genome map
AA seq 536 aa AA seqDB search
MASPQSSHSSLQLPQGMEITAEIKPGYDAILSREALELVAALHRTFEPRRQQLLQARAER
TKRLDAGERPDFLAETKSVRDGDWTIAPLPQDLQCRRVEITGPVERKMIINALNSGADSY
MTDFEDSNAPSWDNQITGHINLKDAVRRTISLEQNGKSYTLNDKVATLIVRPRGWHLDEK
HVKVDGKRVSGGIFDFALFMVHNAKELVARGSGPYFYLPKMESHLEARLWNDIFVAAQEA
VGVPRGTIRATVLIETIVAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKADRDFCL
ADRSQITMTSPFMRAYALLLLKTCHRRNAPAIGGMSALIPIKNDPAANDKAMSGVRSDKA
RDAGDGYDGGWVAHPGLVPIAMEEFVKVLGDKPNQIGKQRDDVLVTATDLTDFRPEAPIT
EGGLRNNINVGIHYLGAWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGKLEDGRK
VTAELVRELSAQELEKVKQAVGGDTKPYERAAQIFEEMSTSEQFTDFLTLPLYEEI
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcccgcagtcctcgcattcatcgttgcagttgccgcagggcatggaaatcacg
gctgaaatcaagccgggctatgacgcgattctctcgcgcgaagcgctcgaactcgtcgcc
gcgctgcatcgcacgttcgagccgcgccgccagcagttgttgcaggcgcgcgcggaacgc
acaaagcgcctcgatgccggcgagcgtccggacttcctcgccgaaacaaaaagcgtgcgt
gacggcgactggacaatcgcgccgctgccgcaggacctgcaatgccgacgcgtggaaatc
accggtccggtcgagcgcaagatgatcatcaacgcgctgaattcgggcgcggattcctac
atgaccgacttcgaagattcgaatgcgccgagctgggataatcagatcaccggccatatc
aatctgaaggacgcggtgcgccgcacgatttcgctggaacagaacggcaagtcgtacacg
ctgaacgacaaggtcgccacgctgatcgtgcgcccgcgcggctggcatctggacgagaag
cacgtgaaggtggacggcaagcgcgtgtcgggcggcatcttcgatttcgcgctcttcatg
gtgcacaacgcgaaggagctggtcgcgcgcggctcgggcccgtacttctatctgccgaag
atggaaagccatctcgaagcacgtctttggaacgacattttcgtggccgcgcaggaagcc
gtcggtgtgccgcgcggcacgattcgcgcaacggtgctgatcgagacaatcgtcgccgct
ttcgaaatggatgagatcctctacgagctgcgcgaacatagctcgggcctgaatgccggc
cgctgggactacatcttttcggcgatcaagaagttcaaggccgaccgcgacttctgtctc
gccgaccgctcgcagatcacgatgacctcgccgttcatgcgcgcctacgcgctgctgttg
ctgaagacttgccatcgccgcaatgcgccggcgatcggcggcatgagcgcgctgattccg
atcaagaacgatccggcggcgaacgacaaggcgatgagcggcgtgcgctcggacaaggcg
cgcgatgccggcgacggctacgacggcggctgggtcgcgcatccgggtctcgtgccgatc
gcaatggaagagttcgtcaaggtgctcggcgacaagccgaaccagatcggcaagcaacgc
gacgacgtactcgtcacggccaccgacctgacggacttccgtccggaagcgccgatcacc
gaaggcggtctgcgcaacaacatcaacgtcggcattcactacctgggcgcgtggctcgca
ggcaatggctgtgtgccgattcacaatctgatggaagacgccgccaccgcggaaatctcg
cgctcgcaggtgtggcagtggatccgctcgccgaagggcaagctcgaagacggccgcaag
gtgacggcggaactggtgcgcgagttatcggcgcaggagctcgagaaggtgaagcaggcc
gtgggcggcgataccaagccgtatgagcgcgccgcgcagatcttcgaagagatgtcgaca
tcggagcagttcaccgacttcctcacgctgccgctgtacgaagaaatttga

DBGET integrated database retrieval system