KEGG   Burkholderia phytofirmans: Bphyt_2490Help
Entry
Bphyt_2490        CDS       T00765                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bpy  Burkholderia phytofirmans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bpy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bphyt_2490
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bphyt_2490
   00630 Glyoxylate and dicarboxylate metabolism
    Bphyt_2490
Enzymes [BR:bpy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bphyt_2490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2810278..2811888
Genome map
AA seq 536 aa AA seqDB search
MASPQSSHSSLQLPQGMEITAEIKPGYDAILSREALELVAALHRTFEPRRQQLLQARAER
TKRLDAGERPDFLAETKSVRDGDWTIAPLPQDLQCRRVEITGPVERKMIINALNSGADSY
MTDFEDSNAPSWDNQITGHINLKDAVRRTISLEQNGKSYTLNDKVATLIVRPRGWHLDEK
HVKVDGKRVSGGIFDFALFMVHNAKELVARGSGPYFYLPKMESHLEARLWNDIFVAAQEA
VGVPRGTIRATVLIETIVAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKADRDFCL
ADRSQITMTSPFMRAYALLLLKTCHRRNAPAIGGMSALIPIKNDPAANDKAMSGVRSDKA
RDAGDGYDGGWVAHPGLVPIAMEEFVKVLGDKPNQIGKQRDDVLVTATDLTDFRPEAPIT
EGGLRNNINVGIHYLGAWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGKLEDGRK
VTAELVRELSAQELEKVKQAVGGDTKPYERAAQIFEEMSTSEQFTDFLTLPLYEEI
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcccgcagtcctcgcattcatcgttgcagttgccgcagggcatggaaatcacg
gctgaaatcaagccgggctatgacgcgattctctcgcgcgaagcgctcgaactcgtcgcc
gcgctgcatcgcacgttcgagccgcgccgccagcagttgttgcaggcgcgcgcggaacgc
acaaagcgcctcgatgccggcgagcgtccggacttcctcgccgaaacaaaaagcgtgcgt
gacggcgactggacaatcgcgccgctgccgcaggacctgcaatgccgacgcgtggaaatc
accggtccggtcgagcgcaagatgatcatcaacgcgctgaattcgggcgcggattcctac
atgaccgacttcgaagattcgaatgcgccgagctgggataatcagatcaccggccatatc
aatctgaaggacgcggtgcgccgcacgatttcgctggaacagaacggcaagtcgtacacg
ctgaacgacaaggtcgccacgctgatcgtgcgcccgcgcggctggcatctggacgagaag
cacgtgaaggtggacggcaagcgcgtgtcgggcggcatcttcgatttcgcgctcttcatg
gtgcacaacgcgaaggagctggtcgcgcgcggctcgggcccgtacttctatctgccgaag
atggaaagccatctcgaagcacgtctttggaacgacattttcgtggccgcgcaggaagcc
gtcggtgtgccgcgcggcacgattcgcgcaacggtgctgatcgagacaatcgtcgccgct
ttcgaaatggatgagatcctctacgagctgcgcgaacatagctcgggcctgaatgccggc
cgctgggactacatcttttcggcgatcaagaagttcaaggccgaccgcgacttctgtctc
gccgaccgctcgcagatcacgatgacctcgccgttcatgcgcgcctacgcgctgctgttg
ctgaagacttgccatcgccgcaatgcgccggcgatcggcggcatgagcgcgctgattccg
atcaagaacgatccggcggcgaacgacaaggcgatgagcggcgtgcgctcggacaaggcg
cgcgatgccggcgacggctacgacggcggctgggtcgcgcatccgggtctcgtgccgatc
gcaatggaagagttcgtcaaggtgctcggcgacaagccgaaccagatcggcaagcaacgc
gacgacgtactcgtcacggccaccgacctgacggacttccgtccggaagcgccgatcacc
gaaggcggtctgcgcaacaacatcaacgtcggcattcactacctgggcgcgtggctcgca
ggcaatggctgtgtgccgattcacaatctgatggaagacgccgccaccgcggaaatctcg
cgctcgcaggtgtggcagtggatccgctcgccgaagggcaagctcgaagacggccgcaag
gtgacggcggaactggtgcgcgagttatcggcgcaggagctcgagaaggtgaagcaggcc
gtgggcggcgataccaagccgtatgagcgcgccgcgcagatcttcgaagagatgtcgaca
tcggagcagttcaccgacttcctcacgctgccgctgtacgaagaaatttga

DBGET integrated database retrieval system