KEGG   Burkholderia pseudomallei 1026b: BP1026B_II0164Help
Entry
BP1026B_II0164    CDS       T02049                                 

Definition
amylase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bpz00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(186360..189005)
Genome map
AA seq 881 aa AA seqDB search
MSARHFGFKQAVLVGSLAALAGAAALPANTSAAEAFGSPGAAPVRGPAAKSFLGTAVNGA
SRVYFTGYRGILSEVYYPVLDTPESVDLQFLVGDAGKTFVDEEKQQAYSAAQTDTRTMSW
QVTTGNSSHNWQIRKIVFADPNHNAIVQRVTFTALNGRKVGDFNLYMLSKPYLDNAGANN
TAQTVSGSGGTALVANHNSRYSALVASRPWKVVNGVGMTSNGFVGQSDGWTDLLGGTADK
TMDWTFSSATNGNVAQMGWLDLGDPSATSVSFDVVLGFGGTQDQALGDANTVLGSDLAGE
QQQYDTGWHNYAAGLSSQNGAADDGYYLAAMTLKTMQDKSNGAMIAGIGTPWGETQGDAN
AGGYHLVWPRDLFKFANALTTAGDTSSATSVVNYLFNTLQQTTDCGTAEYNAPGCAQGYS
RVGRFPQNAWVNGWPYWQGTQMDEQAMPIILAWRLGPSVFNPLWPKIKLTADYIVNTGPW
TYQERWEENAGYSPSTIAAEIAGLVTAADIATQNGDTASAARYLAAADYWQENVAAWTYT
SSGAFGNGSYYIRINPAGRAGTGTDRASFAPTAGPDTPQTLSVKNGGGSHDARRVVDGGF
FELVRMGVKRATDPTIANTISVYDSVLGQTLNVANAPALSPNAWFRYNFDGYGEHNDGGD
FDGTGAGRLWPIFTAERGMVEIARQGSGGAGSAYFSTLKQLTTPEGFVPEQVWSNSTTLP
DGWAVTTPAGYTPGQPTKSMAPLNWAMGEYISLLASIQAGRIVDVPSVVCARYNNCAAPP
QSGQVPVAVNVNASTQLGQQMYVTGNVAALGNWNTDLGIPVDPASYPVWRNTVNLPAAQA
IQYKYYRKNADGSVTWENRSGNRQLQTPASGTLALNDQVSW
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaaggcacttcggattcaagcaggcggtgctggtgggcagtctggccgcgctc
gcgggcgcggcggccctaccggcgaatacttcggctgccgaagcattcggctcgcccggc
gccgcgcccgtgcggggcccggcggccaagtcgttcctcggcacggcggtcaacggcgca
tcgcgggtgtacttcaccggttatcgcggcatcctgtccgaggtctactacccggtcctc
gatacgcccgagtccgtcgacctgcagttcctcgtcggcgacgccggcaagaccttcgtc
gacgaagaaaagcagcaggcctactcggccgcgcaaacggacacgcgcacgatgagctgg
caggtgacgaccggcaacagttcgcacaactggcaaattcgcaagatcgtcttcgccgat
ccgaaccacaacgcgatcgtgcagcgcgtcacgttcaccgcgctcaacggccgcaaggtg
ggcgacttcaatctctacatgctgtccaagccgtacctcgacaacgccggcgccaacaat
accgcgcaaacggtgtccggcagcggcggcaccgcgctcgtcgcgaatcacaacagccgc
tattcggcgctcgtcgcgagccgcccgtggaaggtggtcaacggcgtgggcatgacgtcg
aacggcttcgtcgggcagagcgacggctggaccgacctgctcggcggcaccgccgacaag
acgatggactggaccttctcgtccgcgaccaacggcaacgtcgcgcagatgggctggctc
gacctcggcgatccgagcgcgacgagcgtgtcgttcgacgtcgtgctcggcttcggcggc
acgcaggaccaggcgctcggcgacgcgaacacggtgctcggcagcgatctcgccggcgag
cagcagcagtacgacaccgggtggcataactatgcggcgggcctgtcgtcgcagaacggc
gccgcggacgacggctactacctggccgcgatgacgctcaagacgatgcaggacaagagc
aacggcgcgatgatcgccggcatcggcacgccgtggggcgaaacgcagggcgatgcgaac
gcgggcggctatcacctcgtgtggccgcgcgacctgttcaagttcgcgaacgcgctgacg
acggcgggcgacacgtcgagcgcgacgagcgtcgtcaactacctgttcaacacgctgcag
cagacaaccgattgcggcaccgccgaatacaacgcgcccggctgcgcgcagggctacagc
cgcgtcgggcgctttccgcagaacgcatgggtgaacggctggccgtactggcagggcacg
cagatggacgagcaggcgatgccgatcatcctcgcgtggcgcctcggcccgagcgtgttc
aatccgctgtggccgaagatcaagctcaccgccgactacatcgtcaataccggcccctgg
acgtaccaggagcgctgggaggagaacgccggctattcgccgtcgacgatcgccgccgag
atcgcgggcctcgtcacggcggccgatatcgcgacgcaaaacggcgacacggcgagcgcc
gcgcgctacctcgccgcggccgactactggcaggagaacgtcgcggcgtggacgtacacg
tcgagcggcgcgttcggcaacggcagctactacatccggatcaatccggcgggccgcgcg
ggcaccggcaccgaccgcgcgagcttcgcgccgaccgccggccccgacacgccgcagacg
ctgagcgtgaagaacggcggcggcagccacgacgcgcggcgcgtcgtcgacggcggcttc
ttcgagctcgtccggatgggggtcaagcgcgcgaccgatccgacgatcgccaacacgatc
tcggtctacgacagcgtgctcggccagacgctgaacgtcgcgaacgcgccggcgctgtcg
ccgaacgcgtggttccgctacaacttcgacggctacggcgagcacaacgacggcggcgat
ttcgacggcaccggcgccggccggctgtggccgatcttcaccgccgagcgcggcatggtc
gagatcgcgcgccagggcagcggcggcgcgggcagcgcgtacttctcgacgctcaagcaa
ttgacgacgcccgagggcttcgtgccggagcaggtgtggtcgaattcgacgacgctgccc
gacggctgggcggtgacgacgcccgcgggctacacgccgggccagccgaccaaatcgatg
gcgccgctcaactgggcgatgggcgaatacatcagcctgctcgcgtcgatccaggcgggg
cgcatcgtcgacgtgccgtcggtggtctgcgcgcgctacaacaactgcgccgcgccgccg
caaagcgggcaggtgccggtggccgtcaacgtgaacgcgagcacgcagctcggccagcag
atgtacgtgacaggcaacgtcgccgcgctcggcaattggaacaccgatctcggcattccg
gtcgatccggccagctacccggtgtggcgcaacaccgtcaacctgccggccgctcaggcg
atccagtacaagtactaccggaagaacgcggacggcagcgtgacgtgggagaaccgttcc
ggcaaccgccagcttcagacgcccgcgagcggcacgttggcgctgaacgatcaggtgagc
tggtga

DBGET integrated database retrieval system