KEGG   Bartonella quintana RM-11: RM11_0733Help
Entry
RM11_0733         CDS       T02294                                 

Definition
(GenBank) branched-chain amino acid aminotransferase
  KO
K00826  
branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
bqr  Bartonella quintana RM-11
Pathway
Cysteine and methionine metabolism
Valine, leucine and isoleucine degradation
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bqr00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    RM11_0733
   00280 Valine, leucine and isoleucine degradation
    RM11_0733
   00290 Valine, leucine and isoleucine biosynthesis
    RM11_0733
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    RM11_0733
Enzymes [BR:bqr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     RM11_0733
Amino acid related enzymes [BR:bqr01007]
 Aminotransferase (transaminase)
  Class IV
   RM11_0733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
919955..921061
Genome map
AA seq 368 aa AA seqDB search
MKSPTSSISFKIEKHPSPLSDEKRESILKNPGFGRFFTDHMGIIKWTKDKGWHNAVISQY
KSLEINPASTVLHYAQEIFEGLKAYRAKDGRILLFRPDANAQRFIESARRLAMPELPKDI
FLDAIHQLVRIDQKWVSGNPNASLYIRPFMFGNQNFLGVRPSEEYLFCIIASPVESYFKG
EEKPISVWIETDHSRAGPGGTGAAKCGGNYAASLLAQKNATENNCSQVLFLDMIEHKWIE
ELGGMNVCFIMADNTLVTPALNGTILPGITRHSILKLAQQMGLMIEERPYSFESLQEDAH
KGHLKEVFACGTAAVVTSIGRFKYKGGEFIIGNEMIGKITQKIRTQLVDLQKGNIEDKNG
WVHFVQLS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctcctacatcatcaatttcgtttaaaatagaaaaacacccatcacctttatca
gacgagaaacgtgaaagtattctaaaaaatcctggttttggccgattttttacagatcac
atggggatcattaaatggaccaaagataaaggttggcataacgctgtcatctctcaatac
aaatccctagaaattaatccagcaagtaccgttttgcattatgcgcaagagatttttgaa
ggtttaaaagcctatcgcgcaaaagatggacgcattttgttattccgccctgatgccaat
gcgcaacgttttatagagtcggcaagacgattagccatgccagaattaccaaaggacatt
tttttagatgccattcatcaattagtaagaattgatcagaagtgggtttctggaaatccc
aatgctagcctctacatacgtccattcatgtttggcaatcaaaattttttgggagttcgc
ccttctgaagaatatcttttctgtatcatagcatctcctgttgaatcatatttcaaagga
gaagaaaaacctatcagtgtatggattgaaacagatcatagccgagctggtccaggggga
accggtgctgcgaaatgtggtggaaactatgcagcaagcttacttgcacaaaaaaatgca
actgaaaacaattgtagccaagtgctttttcttgatatgattgaacataaatggattgaa
gagcttggtggtatgaatgtttgctttattatggcagataatacacttgtaacacctgca
cttaatggcaccattcttccaggaataacacgtcattcaattttgaaattggcgcaacaa
atgggtttaatgatagaagaacgcccttattcttttgaatcgctccaggaagatgcacac
aagggtcatcttaaagaagtttttgcttgtggtactgccgctgttgtcacatcaatcggt
cgcttcaaatataaaggtggagagttcataattggaaatgaaatgatcggtaagattacg
caaaaaattcgtacacaattggttgaccttcaaaaaggaaatatagaagataaaaatggc
tgggtacattttgtccagctttcataa

DBGET integrated database retrieval system