KEGG   Brucella canis HSK A52141: BCA52141_I1825Help
Entry
BCA52141_I1825    CDS       T01705                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bsk  Brucella canis HSK A52141
Pathway
bsk00260  Glycine, serine and threonine metabolism
bsk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bsk01100  Metabolic pathways
bsk01110  Biosynthesis of secondary metabolites
bsk01130  Biosynthesis of antibiotics
bsk01230  Biosynthesis of amino acids
Module
bsk_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bsk00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCA52141_I1825
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCA52141_I1825
Enzymes [BR:bsk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BCA52141_I1825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Flavodoxin_1
Motif
Other DBs
NCBI-ProteinID: AEW14165
Position
1:1125746..1127014
Genome map
AA seq 422 aa AA seqDB search
MLSHSPGAPEHDGAETLNKPVAPNSYKTGPDEEGMFGIFGGRFVAETLMPLILELQQAYE
TAKNDPEFKAELNALSTFYAGRPSKLYYAEGLSKHLGGAKIYFKREDLNHTGSHKINNCL
GQILLAKRMGKTRIIAETGAGQHGVASATVAARFGLPCIVYMGATDVERQKPNVFRMKLL
GAEVKPVSAGNGTLKDAMNEALRDWVTNVEDTYYLIGTAAGPHPYPELVRDFQSVIGTEA
RQQILEQEGRLPDVIVAAVGGGSNAIGLFHPFLDDASVKIVGVEAGGRGLEGEEHCASMS
AGRPGVLHGNRTYLLQNADGQILEGHSVSAGLDYPGVGPEHSWLKDSGRVDYVPILDNEA
LDAFQLCTRTEGIIPALESAHAIAQAVKMAPTMGKDKVMIVNLSGRGDKDVHTVGKLLGM
DI
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgctcagccattcgccaggcgcgcctgaacatgacggagcggaaacgttgaacaagccg
gttgcacccaattcctacaagacgggccctgacgaagagggcatgttcggcatattcggt
ggccgcttcgtcgccgaaacgctgatgcctctgatcctcgaattgcagcaggcttatgaa
acggcgaagaatgaccccgaattcaaggcggagttgaacgccctttccaccttttatgcc
ggccgtccttccaagctctattatgccgaaggcctgagcaaacatctgggtggcgctaaa
atctacttcaagcgcgaagacctgaaccataccggcagccacaagatcaacaattgcctt
ggccagatcctgcttgccaagcgcatgggcaagacgcgcatcatcgcagaaacgggcgcc
ggtcagcatggcgtggcgtctgccaccgttgccgcacgcttcggcctgccctgtatcgtc
tatatgggcgcaaccgacgtggagcgccagaagcccaatgttttccgcatgaagctgctc
ggcgcggaagtgaagccggtttctgccggcaatggcacgctgaaagacgcgatgaacgaa
gccctgcgtgactgggttacgaatgtcgaggatacctattacctgatcggcacggctgcc
ggtccgcacccctatcccgaactggtgcgcgatttccaatccgtcatcggcaccgaagcg
cgccagcagatactcgaacaggaaggccgcctgccagatgtgatcgtggcagcggtcggc
ggcggctccaacgccattggcctgttccatccgttcctcgacgacgcctcggtgaagatc
gtcggtgtcgaagcaggcggacgcggtcttgagggagaggaacattgcgcttcgatgagc
gcaggccgccccggcgttctgcatggcaaccgcacctatctcctccagaacgcggatggc
caaattctggaaggccattcggtttccgctggtctcgactatccgggcgtcgggcccgag
cattcgtggctgaaggacagcgggcgcgtcgactatgtgccgatcctcgacaatgaggcg
ctggatgcattccagctttgcacccgcaccgaaggcatcatcccggcgctcgaatccgcc
catgccattgcgcaggccgtcaaaatggcgccgacaatgggcaaggacaaggtgatgatc
gtcaatctgtccggccgcggcgacaaggacgtccacacggtcggcaagcttctcggcatg
gatatctga

DBGET integrated database retrieval system