KEGG   Brucella canis HSK A52141: BCA52141_I1825Help
Entry
BCA52141_I1825    CDS       T01705                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bsk  Brucella canis HSK A52141
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bsk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BCA52141_I1825
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCA52141_I1825
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BCA52141_I1825
Enzymes [BR:bsk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BCA52141_I1825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1125746..1127014
Genome map
AA seq 422 aa AA seqDB search
MLSHSPGAPEHDGAETLNKPVAPNSYKTGPDEEGMFGIFGGRFVAETLMPLILELQQAYE
TAKNDPEFKAELNALSTFYAGRPSKLYYAEGLSKHLGGAKIYFKREDLNHTGSHKINNCL
GQILLAKRMGKTRIIAETGAGQHGVASATVAARFGLPCIVYMGATDVERQKPNVFRMKLL
GAEVKPVSAGNGTLKDAMNEALRDWVTNVEDTYYLIGTAAGPHPYPELVRDFQSVIGTEA
RQQILEQEGRLPDVIVAAVGGGSNAIGLFHPFLDDASVKIVGVEAGGRGLEGEEHCASMS
AGRPGVLHGNRTYLLQNADGQILEGHSVSAGLDYPGVGPEHSWLKDSGRVDYVPILDNEA
LDAFQLCTRTEGIIPALESAHAIAQAVKMAPTMGKDKVMIVNLSGRGDKDVHTVGKLLGM
DI
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgctcagccattcgccaggcgcgcctgaacatgacggagcggaaacgttgaacaagccg
gttgcacccaattcctacaagacgggccctgacgaagagggcatgttcggcatattcggt
ggccgcttcgtcgccgaaacgctgatgcctctgatcctcgaattgcagcaggcttatgaa
acggcgaagaatgaccccgaattcaaggcggagttgaacgccctttccaccttttatgcc
ggccgtccttccaagctctattatgccgaaggcctgagcaaacatctgggtggcgctaaa
atctacttcaagcgcgaagacctgaaccataccggcagccacaagatcaacaattgcctt
ggccagatcctgcttgccaagcgcatgggcaagacgcgcatcatcgcagaaacgggcgcc
ggtcagcatggcgtggcgtctgccaccgttgccgcacgcttcggcctgccctgtatcgtc
tatatgggcgcaaccgacgtggagcgccagaagcccaatgttttccgcatgaagctgctc
ggcgcggaagtgaagccggtttctgccggcaatggcacgctgaaagacgcgatgaacgaa
gccctgcgtgactgggttacgaatgtcgaggatacctattacctgatcggcacggctgcc
ggtccgcacccctatcccgaactggtgcgcgatttccaatccgtcatcggcaccgaagcg
cgccagcagatactcgaacaggaaggccgcctgccagatgtgatcgtggcagcggtcggc
ggcggctccaacgccattggcctgttccatccgttcctcgacgacgcctcggtgaagatc
gtcggtgtcgaagcaggcggacgcggtcttgagggagaggaacattgcgcttcgatgagc
gcaggccgccccggcgttctgcatggcaaccgcacctatctcctccagaacgcggatggc
caaattctggaaggccattcggtttccgctggtctcgactatccgggcgtcgggcccgag
cattcgtggctgaaggacagcgggcgcgtcgactatgtgccgatcctcgacaatgaggcg
ctggatgcattccagctttgcacccgcaccgaaggcatcatcccggcgctcgaatccgcc
catgccattgcgcaggccgtcaaaatggcgccgacaatgggcaaggacaaggtgatgatc
gtcaatctgtccggccgcggcgacaaggacgtccacacggtcggcaagcttctcggcatg
gatatctga

DBGET integrated database retrieval system