KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_1768Help
Entry
A7A1_1768         CDS       T02384                                 

Definition
NADPH cytochrome P450 reductase
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsl00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    A7A1_1768
  Amino acid metabolism
   00380 Tryptophan metabolism
    A7A1_1768
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    A7A1_1768
Enzymes [BR:bsl01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     A7A1_1768
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     A7A1_1768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3269011..3272196)
Genome map
AA seq 1061 aa AA seqDB search
MKETSPIPQPKTFGPLGNLPLIDKDKPTLSLIKLAEEQGPIFQIHTPAGTTIVVSGHELV
KEVCDEERFDKSIEGALEKVRAFSGDGLFTSWTHEPNWRKAHNILMPTFSQRAMKDYHEK
MVDIAVQLIQKWARLNPNEAVDVPGDMTRLTLDTIGLCGFNYRFNSYYRETPHPFINSMV
RALDEAMHQMQRLDVQDKLMVRTKRQFHHDIQTMFSLVDSIIAERRSNGDQDEKDLLARM
LNVEDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFATYFLLKHPDKLKKAYEEVDRV
LTDAAPTYKQVLELTYIRMILNESLRLWPTAPAFSLYPKEDTVIGGKFPITTNDRISVLI
PQLHRDRDAWGKDAEEFRPERFEHQDQVPHHAYKPFGNGQRACIGMQFALHEATLVLGMI
LKYFTLIDHENYELDIKQTLTLKPGDFHIRVQSRNQDAIHADVQAAEKAASDEQKEKTEA
KGTSVIGLNNRPLLVLYGSDTGTAEGVARELADTASLHGVRTETAPLNDRIGKLPKEGAV
VIVTSSYNGKPPSNAGQFVQWLQEIKPGELEGVHYAVFGCGDHNWASTYQYVPRFIDEQL
AEKGATRFSARGEGDVSGDFEGQLDEWKKSMWADAIKAFGLELNENADKERSTLSLQFVR
GLGESPLARSYEASHASIAENRELQSADSDRSTRHIEIALPPDVEYQEGDHLGVLPKNSQ
TNVSRILHRFGLKGTDQVTLSASGHSAGHLPLGRPVSLHDLLSYSVEVQEAATRAQIREL
AAFTVCPPHRRELEELSAEGVYQEQILKKRISMLDLLEKYEACDMPFERFLELLRPLKPR
YYSISSSPRVNPRLASITVGVVRGPAWSGRGEYRGVASNDLAERQAGDDLVMFVRTPESR
FQLPEDPETPIIMVGPGTGVAPFRGFLQAREVLKREGKTLGEAHLYFGCRNDRDFIYRDE
LEQFEKDGIVTVHTAFSRKEGIPKTYVQHVMADHAETLISILDRGGRLYVCGDGSKMAPD
VEAALQKAYQSVHGTGEQEAQNWLRHLQDTGMYAKDVWAGI
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaacaagcccgattcctcaaccgaagacgtttgggccgctcggcaatttgcct
ttaatcgataaagacaagccgacgctttcgctgatcaaactggcggaagaacagggcccg
atttttcaaatccatacacccgcgggcacgaccattgtagtgtccggccacgaattggtg
aaagaggtttgtgatgaagaacggtttgataaaagcattgaaggcgccttggaaaaggtt
cgcgcattttccggtgacggattgtttacgagctggacgcatgagcctaactggagaaaa
gcgcacaacattttgatgccgacgttcagccagcgggccatgaaggactatcatgagaaa
atggtcgatatcgctgttcagctcattcaaaaatgggcaaggctcaacccgaatgaagca
gtcgatgtcccgggagatatgacccggctgacgctcgacaccattgggctatgcgggttt
aactaccgctttaacagttactacagagaaacgccccacccgtttatcaacagcatggtg
cgggcgcttgatgaagcgatgcatcaaatgcagcggcttgatgttcaagataagcttatg
gtcagaacaaagcggcaattccaccatgatattcaaacgatgttttcgttagtcgacagc
attattgcagagcgcagatcgaatggagaccaggatgaaaaagatttgctcgcccgcatg
ctgaatgtggaagatccggaaacgggtgaaaagctcgacgacgaaaatatccgctttcaa
attattacgtttttgattgccggccatgaaacaacgagtggcctgctttcctttgcgact
tattttttattgaagcatcctgacaaactgaaaaaggcgtatgaagaggtcgatcgggtg
ctgacagatgcagcgccgacctataaacaagtgctggagcttacatacatacggatgatt
ttaaatgaatcactgcgcttatggccgacagctccggctttcagcctttatccaaaagaa
gacacagtcattggcgggaaatttccgatcacgacgaatgacagaatttctgtgctgatt
ccgcagcttcatcgtgatcgagacgcttggggaaaggacgcagaagaattccggccggaa
cggtttgagcatcaggaccaagtgcctcatcatgcgtacaaaccattcggaaatggacaa
cgggcctgtatcggcatgcagtttgcccttcatgaagccacacttgtgttaggcatgatt
ctaaaatatttcacattgattgatcatgagaattatgagcttgatatcaaacaaacctta
acacttaagccgggcgattttcacatcagggttcaaagccgtaatcaggatgccattcat
gcagacgtccaggcagctgaaaaagccgcgtctgatgagcaaaaggagaaaacggaagca
aagggcacatcagtcatcggtcttaacaaccgcccgcttctcgtgctgtacggctcagat
accggcaccgcagaaggcgtcgcccgggagcttgcggatactgccagtcttcacggcgta
aggacagagacagcacctctgaacgaccggattggaaagctgccgaaagagggagcggtt
gtcattgtgacctcgtcttataatggaaaaccgccaagcaatgccggacaattcgtgcag
tggcttcaagaaatcaaaccgggtgagcttgagggcgtccattacgcggtatttggctgc
ggcgaccacaactgggcgagcacgtatcaatacgtgccgagattcattgatgagcagctt
gcggagaaaggcgcgactcggttttctgcgcgcggagaaggtgatgtcagcggtgatttt
gaagggcagcttgacgagtggaaaaaaagcatgtgggcggacgccattaaggcattcgga
ctggagctgaatgaaaacgccgataaggaacgaagcacgctaagccttcagtttgtcaga
gggctgggcgagtctccgctggctagatcgtacgaagcctctcacgcatccattgccgaa
aatcgtgaactccagtccgcggacagcgatcgaagcacccgccatatcgaaatcgcattg
ccgccggatgttgaatatcaagagggcgaccatcttggcgtattgccaaaaaacagccaa
accaatgtcagccggattcttcacagattcggtttgaagggaaccgaccaagtgacattg
tcggcaagcggccacagtgcggggcatctgccattgggccgtcctgtcagcctgcatgat
cttctcagctacagcgtcgaggtgcaggaagcagccacaagagcgcaaatacgtgaactg
gcggcatttacagtgtgtccgccgcataggcgcgaattagaagaactgtcagcagagggt
gtttatcaggagcaaatattgaaaaaacgaatttccatgctggatctgcttgaaaagtac
gaagcgtgcgacatgccgtttgaacgatttttagagcttttacgtccgttaaaaccgaga
tattattcaatttcaagctctccaagagtgaatccgcggctagcatcgatcacagtcggc
gtcgtgcgcggccctgcgtggagcggccgtggcgaatacaggggcgtggcttcaaatgat
ttagctgagcgccaagccggtgatgatctcgtgatgtttgtacgcacaccagaatctcgg
tttcagcttccagaagaccctgaaacgccaatcattatggtcggacctggcacgggagtc
gcgccatttcgcggtttccttcaagcccgcgaagttttaaagcgggaggggaaaacgctc
ggtgaagctcatctctattttggatgcagaaacgatcgtgattttatataccgcgatgag
cttgagcagtttgaaaaagacggaatcgtcactgtccacacagccttttcccgtaaagaa
ggcataccgaaaacgtatgtccagcatgtaatggctgaccatgcagaaacgttaatatcg
atccttgaccgcggaggcaggctttatgtatgcggtgatggcagcaaaatggccccggat
gtggaggcggcactacaaaaggcgtatcagtctgtccatggcaccggggagcaagaagcg
caaaactggctgagacatctgcaggataccggtatgtacgctaaggatgtctgggcaggg
atatag

DBGET integrated database retrieval system