KEGG   Bacillus subtilis BSn5: BSn5_06100Help
Entry
BSn5_06100        CDS       T01417                                 

Definition
phospholipase component of bacilysocin synthesis or export
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bsn  Bacillus subtilis BSn5
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bsn00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1130977..1131756)
Genome map
AA seq 259 aa AA seqDB search
MWTWKADRPVAVIVIIHGASEYHGRYKWLIEMWRSSGYHVVMGDLPGQGTTTRARGHIRS
FQEYIDEVDAWIDKARTFDLPVFLLGHSMGGLVAIEWIKQQRNPKITGIILSSPCLGLQI
KVNKALDLASKGLNVIAPSLKVDSGLSIDMATRNEDVIEADQNDSLYVRKVSVRWYRELL
KTIESAMVPTEAFLKVPLLVMQAGDDKLVDKTMVIKWFNGVASHNKAYREWEGLYHEIFN
EPEREDVFKAARAFTDQYI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtggacctggaaagcagacagacctgttgcagtgattgtaatcattcacggggcaagt
gaatatcacggacgatataaatggctgattgaaatgtggcggtcttcgggttatcacgtt
gtcatgggcgatttgcctggacagggaacaacgacaagagcgagagggcatattcgctcg
tttcaagaatacattgatgaagtagatgcttggatagataaagcgcgaacttttgatctg
ccggtttttcttctaggtcacagcatgggcggtctggtcgcgattgaatggattaaacag
caaagaaatcccaagattacgggaattattttatcatcaccgtgtctcggactgcaaatt
aaagtgaataaagcgcttgatcttgcatcaaaaggcctgaatgtcatcgctccgtcactt
aaggttgattcgggattatcaattgatatggcgacgcgcaatgaggacgtcattgaggct
gaccaaaatgattcgttatacgtcaggaaagtttctgtcagatggtacagagagctttta
aagacaattgaatcggcaatggtgccgacagaggcatttttgaaagttccgcttcttgtg
atgcaagccggtgatgacaagcttgttgacaaaacgatggtcatcaagtggtttaatggt
gttgcttctcataataaagcatacagagagtgggaagggctttaccatgagatcttcaat
gaacccgagagagaagatgtttttaaagcagcaagagcgtttactgatcaatatatttga

DBGET integrated database retrieval system