KEGG   Bacillus subtilis BSn5: BSn5_06100Help
Entry
BSn5_06100        CDS       T01417                                 

Definition
(GenBank) phospholipase component of bacilysocin synthesis or export
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
bsn  Bacillus subtilis BSn5
Pathway
bsn00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bsn00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BSn5_06100
Enzymes [BR:bsn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BSn5_06100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Abhydrolase_5 Abhydrolase_2 PGAP1 Ser_hydrolase Chlorophyllase2 DUF1350 LCAT Thioesterase Abhydrolase_3 Peptidase_S9 LIDHydrolase DUF676 Esterase
Motif
Other DBs
NCBI-ProteinID: ADV93848
Position
complement(1130977..1131756)
Genome map
AA seq 259 aa AA seqDB search
MWTWKADRPVAVIVIIHGASEYHGRYKWLIEMWRSSGYHVVMGDLPGQGTTTRARGHIRS
FQEYIDEVDAWIDKARTFDLPVFLLGHSMGGLVAIEWIKQQRNPKITGIILSSPCLGLQI
KVNKALDLASKGLNVIAPSLKVDSGLSIDMATRNEDVIEADQNDSLYVRKVSVRWYRELL
KTIESAMVPTEAFLKVPLLVMQAGDDKLVDKTMVIKWFNGVASHNKAYREWEGLYHEIFN
EPEREDVFKAARAFTDQYI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtggacctggaaagcagacagacctgttgcagtgattgtaatcattcacggggcaagt
gaatatcacggacgatataaatggctgattgaaatgtggcggtcttcgggttatcacgtt
gtcatgggcgatttgcctggacagggaacaacgacaagagcgagagggcatattcgctcg
tttcaagaatacattgatgaagtagatgcttggatagataaagcgcgaacttttgatctg
ccggtttttcttctaggtcacagcatgggcggtctggtcgcgattgaatggattaaacag
caaagaaatcccaagattacgggaattattttatcatcaccgtgtctcggactgcaaatt
aaagtgaataaagcgcttgatcttgcatcaaaaggcctgaatgtcatcgctccgtcactt
aaggttgattcgggattatcaattgatatggcgacgcgcaatgaggacgtcattgaggct
gaccaaaatgattcgttatacgtcaggaaagtttctgtcagatggtacagagagctttta
aagacaattgaatcggcaatggtgccgacagaggcatttttgaaagttccgcttcttgtg
atgcaagccggtgatgacaagcttgttgacaaaacgatggtcatcaagtggtttaatggt
gttgcttctcataataaagcatacagagagtgggaagggctttaccatgagatcttcaat
gaacccgagagagaagatgtttttaaagcagcaagagcgtttactgatcaatatatttga

DBGET integrated database retrieval system