KEGG   Bacillus subtilis BSn5: BSn5_11155Help
Entry
BSn5_11155        CDS       T01417                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bsn  Bacillus subtilis BSn5
Pathway
bsn00220  Arginine biosynthesis
bsn00330  Arginine and proline metabolism
bsn01100  Metabolic pathways
bsn01110  Biosynthesis of secondary metabolites
bsn01130  Biosynthesis of antibiotics
bsn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsn00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BSn5_11155
   00330 Arginine and proline metabolism
    BSn5_11155
Enzymes [BR:bsn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BSn5_11155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase SHOCT
Motif
Other DBs
NCBI-ProteinID: ADV94847
Position
complement(2139372..2140262)
Genome map
AA seq 296 aa AA seqDB search
MDKTISVIGMPMDLGQARRGVDMGPSAIRYAHLIERLSDMGYTVEDLGDIPINREKIKND
EELKNLNSVLAGNEKLAQKVNKVIEEKKFPLVLGGDHSIAIGTLAGTAKHYDNLGVIWYD
AHGDLNTLETSPSGNIHGMPLAVSLGIGHESLVNLEGYAPKIKPENVVIIGARSLDEGER
KYIKESGMKVYTMHEIDRLGMTKVIEETLDYLSACDGVHLSLDLDGLDPNDAPGVGTPVV
GGISYRESHLAMEMLYDAGIITSAEFVEVNPILDHKNKTGKTAVELVESLLGKKLL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggataaaacgatttcggttattggaatgccaatggatttaggacaagcacgacgcgga
gtggatatgggcccgagcgccatccggtacgctcatctgatcgagcggctgtcggacatg
gggtatacggttgaagatctcggtgacattccgatcaaccgcgaaaaaatcaaaaatgac
gaggaactgaaaaacctgaattccgttttggcgggaaatgaaaaactcgcgcaaaaggtc
aacaaagtcattgaagagaaaaaattcccgcttgtcctgggcggtgaccacagtattgcg
atcggcacgcttgcaggcacagcgaagcattacgataatctcggcgtcatctggtatgac
gcgcacggcgatctgaatacacttgaaacttcaccatcgggcaatattcacggcatgccg
ctcgcggtcagcctcggcattggccacgagtcactggttaaccttgaaggctacgcgcct
aaaatcaaaccggaaaacgtcgttatcattggcgcccggtcacttgatgaaggggagcgc
aagtacattaaggaaagcggcatgaaggtgtacacaatgcacgaaatcgaccgtcttggc
atgacaaaggtcattgaagaaacccttgattatttatcagcatgtgatggcgtccatctg
agccttgatctggacggacttgatccgaacgacgcaccgggtgtcggaacccctgtcgtc
ggcggcatcagctaccgggagagccatctggctatggaaatgctgtatgacgcaggcatc
attacctcagccgaattcgttgaggttaacccgatccttgatcacaaaaacaaaacaggc
aaaacagcagtagagctcgtagaatccctgttagggaagaagctgctgtaa

DBGET integrated database retrieval system