KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_2031Help
Entry
I33_2031          CDS       T01837                                 

Definition
endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    I33_2031
Enzymes [BR:bsr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     I33_2031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1922629..1924128
Genome map
AA seq 499 aa AA seqDB search
MKRSISIFITCLLITLLTMGGMLASPASAAGKKTPVAKNGQLSIKGTQLVNRDGKAVQLK
GISSHGLQWYGEYVNKDSLKWLRDDWGITVFRAAMYTADGGYIDNPSVKNKVKEAVEAAK
ELGIYVIIDWHILNDGNPNQNKEKAKEFFKEMSSLYGNTPNVIYEIANEPNGDVNWKRDI
KPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQLKDANVMYALHFYAGTHGQFLR
DKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLKYLDSKTISWVNWNLSDKQESS
SALKPGASKTGGWRLSDLSASGTFVRENILGTKDSTKDIPEKPAQDKPTQENGISVQYRA
GDGSINSNQISTQLQIKNNGNTTVDLKDVTARYWYNAKNKGQNFDCDYAQLGCGNMTHKF
VTLHKPKQGADTYLELGFKNGTLAPGASTGNIQLRLHNDDWSNYAQSGDYSFFKSNTFKT
TKKITLYDKGKLIWGTEPN
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggtcaatctctatttttattacgtgtttattgattacgttattgacaatgggc
ggcatgctggcttcgccggcatcagcagcagggaaaaaaacgccagtagccaagaatggc
cagcttagcataaaaggtacacagctcgttaaccgagacggtaaagcggtacagctgaag
gggatcagttcacacggattgcaatggtatggagaatatgtcaataaagacagcttaaaa
tggctgagggacgattggggtatcaccgttttccgtgcagcgatgtatacggcagatggc
ggttatattgacaacccgtccgtgaaaaataaagtaaaagaagcggttgaagctgcaaaa
gagcttgggatatatgtcatcattgactggcatatcttaaatgacggtaatccaaaccaa
aataaagagaaggcaaaagaattcttcaaggaaatgtcaagcctttacggaaacacgcca
aacgtcatttatgaaattgcaaacgaaccaaacggtgatgtgaactggaagcgtgatatt
aaaccgtatgcggaagaagtgatttccgttatccgcaaaaatgatccagacaacatcatc
attgtcggaaccggtacatggagccaggatgtgaatgatgctgccgatgaccagctaaaa
gatgcaaacgttatgtacgcacttcatttttatgccggcacacacggccagtttttacgg
gataaagcaaactatgcactcagcaaaggagcgcctatttttgtgacagaatgggggaca
agtgatgcttccggaaatggcggtgtattccttgatcaatcgcgggaatggctgaaatat
ctcgatagcaagaccattagctgggtaaactggaatctttctgataagcaggaatcatcc
tcagctttaaagccgggggcatctaaaacaggcggctggcggttgtcagatttatctgct
tcaggaacattcgttagagaaaacattctcggcaccaaagattcgacgaaggacattcct
gaaaagccagcacaagataaacccacacaggaaaacggtatttctgtacaatacagagca
ggggatgggagtatcaacagcaaccaaatcagtacgcagcttcaaataaaaaataacggc
aataccacggttgatttaaaagatgtcactgcccgttactggtataacgcgaaaaacaaa
ggccaaaattttgactgtgactacgcgcagcttggatgcggcaatatgacacacaagttt
gtgacgttgcataaaccaaagcaaggtgcagatacctatctggaacttgggtttaaaaac
ggaacgctggcaccaggagcaagcacagggaatattcagcttcgtcttcacaatgatgac
tggagcaattatgcacaaagcggcgattattcctttttcaaatcaaatacgtttaaaaca
acgaaaaaaatcacattatatgataaaggaaaactgatttggggaacagaaccaaattag

DBGET integrated database retrieval system