KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_12315Help
Entry
BSUW23_12315      CDS       T01302                                 

Gene name
glcK
Definition
(GenBank) glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
bss00010  Glycolysis / Gluconeogenesis
bss00052  Galactose metabolism
bss00500  Starch and sucrose metabolism
bss00520  Amino sugar and nucleotide sugar metabolism
bss00521  Streptomycin biosynthesis
bss01100  Metabolic pathways
bss01110  Biosynthesis of secondary metabolites
bss01120  Microbial metabolism in diverse environments
bss01130  Biosynthesis of antibiotics
bss01200  Carbon metabolism
Module
bss_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bss_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSUW23_12315 (glcK)
   00052 Galactose metabolism
    BSUW23_12315 (glcK)
   00500 Starch and sucrose metabolism
    BSUW23_12315 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    BSUW23_12315 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BSUW23_12315 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BSUW23_12315 (glcK)
Enzymes [BR:bss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BSUW23_12315 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase FtsA
Motif
Other DBs
NCBI-ProteinID: ADM38501
UniProt: E0U433
Position
complement(2427623..2428588)
Genome map
AA seq 321 aa AA seqDB search
MDEIWFAGIDLGGTTIKLAFINQYGEIQHKWEVPTDKSGDTITVTIAKTIDSKLDELQKP
KHIIKYIGMGAPGPVDMAAGVVYETVNLGWKNYALKNHLETETGIPAVIENDANIAALGE
MWKGAGDGAKDVILVTLGTGVGGGIIVNGEIVHGINGAGGEIGHICSIPEGGAPCNCGKT
GCIETIASATGIVRIAKEKIANAKQTTRLKATEQLSARDVFEAAGKNDEIALEVVDYVAK
HLGLVLGNLASSLNPSKIVLGGGVSRAGELLRSKVEKTFRKCAFPRAAEAADISIAALGN
DAGVIGGAWIAKNEWLKHQNC
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaatatggtttgcgggcattgatctgggaggaacgacaattaaactcgctttt
attaatcaatatggtgaaattcagcataagtgggaagttccaactgataaaagcggcgac
actattaccgttacaattgcaaaaacaatcgacagtaagctggatgagctgcaaaaacca
aagcatatcatcaaatacatcggaatgggcgcaccaggccctgtagatatggcggcagga
gtcgtttatgaaacggtaaatctggggtggaaaaactatgctttaaagaaccatctcgag
acagaaaccggaatcccggctgttatagaaaacgacgcgaatattgctgcgctcggggaa
atgtggaagggagcgggtgatggcgcgaaagacgtcattctcgtaacgcttggcacagga
gttggcggcggcatcattgtaaatggtgaaattgtacatggcataaatggcgccggcggg
gaaatcggccatatttgcagcattcctgaaggcggggcgccttgcaactgcggcaaaacg
ggctgtatcgaaacgattgcgtcggcaaccggaattgtaagaattgcaaaagagaaaatt
gcaaatgctaagcagacgacacgtttaaaagcaactgaacaattgtcagcgcgggatgta
tttgaagcggcgggtaaaaatgacgaaattgcccttgaagtggttgattatgtggccaag
catcttggtttggtgctgggaaatttggcaagctcgcttaatccgtcaaaaatcgttctt
ggcggcggcgtatcgagagccggagaactgctgagatccaaagtcgagaaaacattccgc
aaatgtgcgtttccgagggcagccgaagcggctgatatttcaattgcagcacttggaaat
gatgctggcgttatcggcggcgcttggatcgctaaaaatgaatggctgaaacatcaaaat
tgttaa

DBGET integrated database retrieval system