KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_12315Help
Entry
BSUW23_12315      CDS       T01302                                 

Gene name
glcK
Definition
glucose kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BSUW23_12315 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSUW23_12315 (glcK)
   00052 Galactose metabolism
    BSUW23_12315 (glcK)
   00500 Starch and sucrose metabolism
    BSUW23_12315 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    BSUW23_12315 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BSUW23_12315 (glcK)
   00524 Butirosin and neomycin biosynthesis
    BSUW23_12315 (glcK)
Enzymes [BR:bss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BSUW23_12315 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2427623..2428588)
Genome map
AA seq 321 aa AA seqDB search
MDEIWFAGIDLGGTTIKLAFINQYGEIQHKWEVPTDKSGDTITVTIAKTIDSKLDELQKP
KHIIKYIGMGAPGPVDMAAGVVYETVNLGWKNYALKNHLETETGIPAVIENDANIAALGE
MWKGAGDGAKDVILVTLGTGVGGGIIVNGEIVHGINGAGGEIGHICSIPEGGAPCNCGKT
GCIETIASATGIVRIAKEKIANAKQTTRLKATEQLSARDVFEAAGKNDEIALEVVDYVAK
HLGLVLGNLASSLNPSKIVLGGGVSRAGELLRSKVEKTFRKCAFPRAAEAADISIAALGN
DAGVIGGAWIAKNEWLKHQNC
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaatatggtttgcgggcattgatctgggaggaacgacaattaaactcgctttt
attaatcaatatggtgaaattcagcataagtgggaagttccaactgataaaagcggcgac
actattaccgttacaattgcaaaaacaatcgacagtaagctggatgagctgcaaaaacca
aagcatatcatcaaatacatcggaatgggcgcaccaggccctgtagatatggcggcagga
gtcgtttatgaaacggtaaatctggggtggaaaaactatgctttaaagaaccatctcgag
acagaaaccggaatcccggctgttatagaaaacgacgcgaatattgctgcgctcggggaa
atgtggaagggagcgggtgatggcgcgaaagacgtcattctcgtaacgcttggcacagga
gttggcggcggcatcattgtaaatggtgaaattgtacatggcataaatggcgccggcggg
gaaatcggccatatttgcagcattcctgaaggcggggcgccttgcaactgcggcaaaacg
ggctgtatcgaaacgattgcgtcggcaaccggaattgtaagaattgcaaaagagaaaatt
gcaaatgctaagcagacgacacgtttaaaagcaactgaacaattgtcagcgcgggatgta
tttgaagcggcgggtaaaaatgacgaaattgcccttgaagtggttgattatgtggccaag
catcttggtttggtgctgggaaatttggcaagctcgcttaatccgtcaaaaatcgttctt
ggcggcggcgtatcgagagccggagaactgctgagatccaaagtcgagaaaacattccgc
aaatgtgcgtttccgagggcagccgaagcggctgatatttcaattgcagcacttggaaat
gatgctggcgttatcggcggcgcttggatcgctaaaaatgaatggctgaaacatcaaaat
tgttaa

DBGET integrated database retrieval system