KEGG   Bacillus subtilis subsp. subtilis 168: BSU13900Help
Entry
BSU13900          CDS       T00010                                 

Gene name
ptsH
Definition
(RefSeq) phosphocarrier protein HPr
  KO
K11189  
phosphocarrier protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
Transporters [BR:bsu02000]
 Phosphotransferase System (PTS)
  Enzyme I and HPr
   Phosphocarrier protein HPr [TC:8.A.8 4.A.2]
    BSU13900 (ptsH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Structure
PDB: 

Jmol
Position
1459384..1459650
Genome map
AA seq 88 aa AA seqDB search
MAQKTFKVTADSGIHARPATVLVQTASKYDADVNLEYNGKTVNLKSIMGVMSLGIAKGAE
ITISASGADENDALNALEETMKSEGLGE
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaaaaacatttaaagtaactgcagattctggaatccatgctcgtcctgcgaca
gttcttgtacaaactgctagcaaatacgacgctgacgttaatttagaatataacggcaaa
acagttaaccttaaatctattatgggtgttatgtctttaggtatcgctaaaggcgctgag
atcacaatctctgcttccggagctgacgaaaacgatgctcttaacgctttagaagaaaca
atgaaaagcgaaggactcggcgagtaa

DBGET integrated database retrieval system