KEGG   Bacillus subtilis subsp. subtilis 168: BSU18450Help
Entry
BSU18450          CDS       T00010                                 

Gene name
gltA
Definition
(RefSeq) glutamate synthase [NADPH] large chain
  KO
K00265  glutamate synthase (NADPH/NADH) large chain [EC:1.4.1.13 1.4.1.14]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00250  Alanine, aspartate and glutamate metabolism
bsu00910  Nitrogen metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01130  Biosynthesis of antibiotics
bsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    BSU18450 (gltA)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSU18450 (gltA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     BSU18450 (gltA)
    1.4.1.14  glutamate synthase (NADH)
     BSU18450 (gltA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_2 Glu_synthase Glu_syn_central GXGXG
Motif
Other DBs
NCBI-GeneID: 940024
NCBI-ProteinID: NP_389727
Pasteur: BG10811
BSORF: BG10811
UniProt: P39812
Position
complement(2010070..2014632)
Genome map
AA seq 1520 aa AA seqDB search
MTYNQMPKAQGLYRPEFEHDACGIGLYAHLKGKQTHDIVKQGLKMLCQLDHRGGQGSDPD
TGDGAGLLVQIPDAFFRKECKNINLPEKERYGVGMVFFSQKEDERKKIEKQINALIEQEG
QVVLGWRTVPVNVGKIGTVAQKSCPFVRQVFIGASSDLKDNLSFERKLYVIRKQAENWGV
TEGLDFYFASLSSQTIVYKGLLTPEQVDAFYSDLQDEAFVSAFALVHSRFSTNTFPTWER
AHPNRYLVHNGEINTLRGNINWMRAREQQFVSESFGEDLNKILPILNADGSDSSILDNAF
EFFVMAGRKPAHTAMMLIPEPWTENTHMSKEKRAFYEYHSSLMEPWDGPTAISFTDGKQI
GAILDRNGLRPARYYVTKDDYIIFSSEVGVIEVEQENVLYKNRLEPGKMLLIDLEEGRII
SDEEVKTQIATEYPYQKWLEEELVQVNPDPESREEEQFSDLLTRQKAFGYTYEDIQKYLI
PVIKEGKDPLGSMGNDAPLAVLSDRAQSLFNYFKQLFAQVTNPPIDAIREQLVTSTMTWL
GAEGDLLHPSERNVRRIKLYTPVLSNEQFYALKTIVHPDLKSQKIDVLFSEDLERGLKDM
FTQAEKAISQGVSLLILSDKKMNERLTPIPPLLAVSALHQHLIRKGLRTKVSIIVESGEA
REVHHFAALIGYGADAINPYLAYATYKQEIDEGRLDISYEEAVSKYGKSITEGVVKVMSK
MGISTVQSYRGAQIFEAVGISRDVIDRYFSGTASQLGGIDLQTIAEEAQRRHREAYQDDY
SKTLEPGSDFQWRNGGEHHAFNPKTIHTLQWACRRNDYNLFKQYTKAADEERIGFLRNLF
AFDGNRKPLKLEEVESAESIVKRFKTGAMSFGSLSKEAHEALAIAMNRLGGKSNSGEGGE
DPKRFVPDENGDDRRSAIKQIASGRFGVKSHYLVNADELQIKMAQGAKPGEGGQLPGNKV
YPWVADVRGSTPGVGLISPPPHHDIYSIEDLAQLIHDLKNANRDARISVKLVSKAGVGTI
AAGVAKATADVIVISGYDGGTGASPKTSIKHTGLPWELGLAEAHQTLMLNGLRDRVVLET
DGKLMTGRDVVMAALLGAEEFGFATAPLVVLGCVMMRACHLDTCPVGVATQNPELRKKFM
GDPDHIVNYMLFIAEEVREYMAALGFKTFDEMIGRTDVLHASERAKEHWKASQLDLSTLL
YQPEGVRTFQSPQNHKIDQSLDITTILPAVQEAIESGKEADISIEINNTNRVAGTITGSE
ISKRYGEEGLPEDTIKLHFTGSAGQSFGAFVPKGMTLYLDGDSNDYVGKGLSGGKIIVKS
SEGFNSASDDNVIIGNVAFYGATSGEAYINGRAGERFAVRNSGVNVVVEGIGDHGCEYMT
GGSVVVLGDVGKNFAAGMSGGIAYVLTEDVKAFKRKCNLEMILFESLEDEKEIQQIKAML
ERHTAYTNSQKAEDLLDQWEDSVKKFVKVIPKNYKQMLASIEEQKAAGLSDEEAIMFAFE
ANTKPKQNTAASGQKQAVVQ
NT seq 4563 nt NT seq  +upstreamnt  +downstreamnt
atgacgtacaatcaaatgccaaaagctcaaggtctctaccgtcctgaatttgaacatgat
gcatgcggaatcggcctatatgcacacttaaagggcaagcagactcacgacattgtcaaa
caaggacttaagatgctttgccagctagaccatagaggagggcaaggcagtgatccggat
acaggagacggagccggcttactggttcaaatccctgatgctttctttagaaaagagtgc
aaaaacatcaatctgccagaaaaagaacgttacggggtaggaatggtctttttctcacag
aaggaagatgaaagaaaaaaaattgaaaagcaaatcaatgcactaattgaacaagaaggc
caagtcgttcttggatggagaactgtacctgtaaatgtcggaaaaatcggaacagtggcg
caaaaaagctgtccgtttgtccgtcaggtatttatcggcgcaagttctgatctaaaggac
aatttatcttttgaacgaaaattgtatgtcattcgtaaacaggctgaaaattggggagta
acggaaggtcttgatttttattttgccagtctttcaagccagaccattgtttacaaaggc
cttttaacacctgaacaggttgatgcattttattctgatctgcaagacgaagcattcgtt
tctgcttttgcgcttgttcattcacgcttcagtaccaatacattccctacatgggaaaga
gcgcatcctaaccgctatttggttcacaacggtgaaattaacacccttcgcggaaatatc
aactggatgagagcacgtgagcagcaatttgtttctgaaagcttcggtgaggacttaaac
aagattttgccgattctcaatgctgatggcagtgactcttccattttggataacgcattt
gagttttttgtgatggctggacgcaaaccggcacatacggcaatgatgctcattccagag
ccttggacggaaaatacgcatatgtccaaggaaaaaagggcgttctacgagtaccatagc
tccctgatggagccttgggacggaccgacagctatttcatttactgacggtaaacaaatc
ggggcgatccttgaccggaacggtctccgtccggcccgttattatgtcacaaaagatgat
tatattattttctcatctgaagtaggcgttattgaagttgaacaggagaacgttttatat
aaaaaccgccttgagcctgggaaaatgcttttaatcgacctggaagaaggccgtattatc
tccgatgaggaagtcaaaacacaaattgcaactgagtatccgtaccaaaaatggcttgaa
gaagagcttgtacaagtaaatcctgatccggagtcaagagaagaagaacaatttagtgat
cttcttactcgccagaaggcattcggatacacatatgaggatatccaaaagtatctaatt
cctgttattaaagaaggcaaagatccccttggttcaatggggaatgacgctccgcttgct
gtactttctgaccgagcgcaatcgctgtttaactactttaaacagctgtttgcacaagta
acgaacccgccaatcgacgcgattcgtgagcagcttgtcacttcaacgatgacttggctc
ggtgcggaaggcgatcttcttcatccaagtgaacgaaatgttcgccggattaaactgtat
acacctgttttatccaatgaacagttttacgcattgaaaacgattgttcatcctgattta
aaaagccaaaaaattgatgtgctgttttcagaggatcttgaacgcggtttaaaggacatg
ttcacacaggcagagaaagccatcagccaaggcgtaagtttgttaattttatcagacaaa
aagatgaacgaacgactgacaccaattccgccgcttctggcagtaagcgcactgcaccag
cacttaatccgcaaagggctgcgtacgaaggtcagcattattgtggaatcgggagaagca
cgtgaagtgcatcactttgcagcgttaatcggttatggcgcagatgcgattaacccttat
ctcgcttatgcgacctacaagcaggaaattgatgaaggccgtttggatatcagctatgaa
gaagcggttagcaaatatggaaaaagcattactgagggcgtcgtaaaagtgatgtccaag
atgggaatttcaactgtgcaaagctacagaggcgcacaaatctttgaggcggtaggaatc
agccgcgatgtgatcgaccgctatttctcaggtactgcatcacagctaggcggcatcgat
ttacaaacaattgcagaagaggcacagcgccgccaccgggaagcgtatcaggatgattac
agcaaaacgcttgaaccgggaagtgacttccaatggagaaatggcggagagcatcatgcg
tttaatccgaaaacgattcatactttgcaatgggcgtgccgcagaaatgattacaatctg
tttaaacagtatacaaaagcggctgatgaagaacgcatcggatttttgcggaacttgttc
gcatttgacggaaaccgcaagcctttgaagttggaggaggttgaatccgctgaatcgatt
gtcaaacgttttaaaacgggtgcgatgtcattcgggtccttgagtaaggaagcgcacgaa
gctttagcaatcgcaatgaaccgtcttggaggaaaaagcaacagcggtgaaggcggagaa
gatcccaaacgctttgttccagatgagaacggcgatgatagaagaagtgcgatcaaacaa
attgcatccggacggtttggtgtcaaaagccattacctcgtcaatgctgatgagctgcag
attaaaatggctcaaggtgctaagccgggtgaaggcgggcagcttcctggcaacaaggta
tatccatgggttgccgatgtccgtgggtcaacgccaggtgtcggattaatctcacctccg
ccacaccatgacatttattcgattgaggatttagcccagctgatccacgatttgaaaaat
gccaaccgtgacgcaagaatcagcgtaaagctggtgtcaaaagcaggtgtaggaacaatc
gctgcaggtgttgccaaagcgactgcagatgtcattgtgatcagcggctatgacggaggt
acaggcgcttctccgaaaaccagtattaaacatacagggcttccgtgggagcttggcctt
gcagaagcacatcaaacactaatgctgaacggacttcgtgaccgtgttgtattagaaaca
gatggaaagctcatgacgggccgcgacgttgtgatggctgccttgctcggcgccgaagaa
tttggtttcgcaacggctccgttagttgtactcggctgtgtcatgatgcgtgcctgccat
ttggatacatgccctgtcggtgtagcgacacaaaatccagagcttcgcaaaaagttcatg
ggagatcctgaccatattgtgaactatatgctgttcattgccgaagaagttcgtgagtac
atggctgcgttaggcttcaagacatttgatgaaatgatcggccgcactgatgtacttcat
gcaagtgaacgggcaaaggagcactggaaagcaagccagcttgatttgtctacccttctt
tatcagcctgaaggggtgcggacgttccaatcgccgcaaaatcataaaattgatcaatca
cttgatattacaacaattctcccggccgtacaagaagccatcgaatctggaaaagaagct
gatatttcgattgaaatcaataatacaaatcgtgtagccggaacgataaccggcagtgaa
atctcaaagcgttacggagaagaaggtcttcctgaagatacaatcaagctgcactttacc
ggatcagccggccaaagctttggagctttcgttcctaaagggatgacgctttatttggac
ggagactcaaatgattacgtcggaaaagggctttctggcggaaaaatcatcgtcaagtca
tcagaaggattcaactctgcttcggatgacaatgtcattatcggcaacgtggctttttac
ggtgcgacaagcggagaagcatatattaacgggcgtgctggtgaacgctttgccgttcga
aacagcggtgtgaacgtagttgtagaaggcatcggcgaccacggctgtgaatacatgact
ggcggcagcgttgtcgttctcggtgatgtaggcaaaaactttgcggcaggtatgtccggc
ggaatcgcttatgtactgaccgaagatgtcaaagcgtttaaacgcaaatgcaaccttgag
atgattttatttgaatcattagaggatgagaaagaaatccagcaaatcaaagcaatgctt
gaaagacatactgcgtatacaaacagccaaaaagcagaagatctgctagatcaatgggaa
gacagtgtgaaaaaattcgtcaaagtcattccgaaaaactataaacaaatgctcgcaagc
atcgaagagcaaaaagctgcaggtttatcagatgaagaagccatcatgttcgcttttgag
gccaacacgaagccaaagcagaatacagcagcatcgggacaaaaacaagcggtagtacag
taa

DBGET integrated database retrieval system