KEGG   Bacillus subtilis subsp. subtilis 168: BSU21750Help
Entry
BSU21750          CDS       T00010                                 

Gene name
scuA
Definition
(RefSeq) SCO1 protein
  KO
K07152  
protein SCO1/2
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
Mitochondrial biogenesis [BR:bsu03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    BSU21750 (scuA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Pasteur: 
BSORF: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2291703..2292284)
Genome map
AA seq 193 aa AA seqDB search
MKVIKGLTAGLIFLFLCACGGQQIKDPLNYEVEPFTFQNQDGKNVSLESLKGEVWLADFI
FTNCETICPPMTAHMTDLQKKLKAENIDVRIISFSVDPENDKPKQLKKFAANYPLSFDNW
DFLTGYSQSEIEEFALKSFKAIVKKPEGEDQVIHQSSFYLVGPDGKVLKDYNGVENTPYD
DIISDVKSASTLK
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttatcaaggggttaacggctgggctgatttttctgtttttgtgtgcatgcgga
ggacagcagattaaagatccgctcaattacgaggtggagccttttacatttcaaaaccaa
gacggcaagaacgtttctttagagagtttaaaaggagaagtatggctggcggattttatt
tttaccaattgtgaaactatatgtccgccaatgaccgctcatatgaccgatctgcaaaaa
aaactgaaagccgaaaatatagatgtccgcatcatatcatttagtgttgatccagaaaac
gataagccgaaacagctgaagaaatttgccgcaaattatccattatcttttgataactgg
gattttctcacgggatacagccagagtgagattgaggagttcgcacttaagagctttaaa
gcgatcgtaaagaagccggagggagaggaccaagtgattcatcaatcttctttttatttg
gtaggtccggacggtaaggtgctgaaagattacaatggagtggagaatacaccgtacgat
gatatcatttccgatgtgaagtcagccagtacactcaagtaa

DBGET integrated database retrieval system