KEGG   Bacillus subtilis subsp. subtilis 168: BSU24220Help
Entry
BSU24220          CDS       T00010                                 

Gene name
spo0A
Definition
(RefSeq) stage 0 sporulation protein A
  KO
K07699  
two-component system, response regulator, stage 0 sporulation protein A
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
Two-component system
Quorum sensing
Module
KinABCDE-Spo0FA (sporulation control) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BSU24220 (spo0A)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    BSU24220 (spo0A)
Two-component system [BR:bsu02022]
 Spo family
  KinABCDE-Spo0FA [MD:M00485]
   BSU24220 (spo0A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
BSORF: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2518023..2518826)
Genome map
AA seq 267 aa AA seqDB search
MEKIKVCVADDNRELVSLLSEYIEGQEDMEVIGVAYNGQECLSLFKEKDPDVLVLDIIMP
HLDGLAVLERLRESDLKKQPNVIMLTAFGQEDVTKKAVDLGASYFILKPFDMENLVGHIR
QVSGNASSVTHRAPSSQSSIIRSSQPEPKKKNLDASITSIIHEIGVPAHIKGYLYLREAI
SMVYNDIELLGSITKVLYPDIAKKFNTTASRVERAIRHAIEVAWSRGNIDSISSLFGYTV
SMTKAKPTNSEFIAMVADKLRLEHKAS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtggagaaaattaaagtttgtgttgctgatgataatcgagagctggtaagcctgttaagt
gaatatatagaaggacaggaagacatggaagtgatcggcgttgcttataacggacaggaa
tgcctgtcgctgtttaaagaaaaagatcccgatgtgctcgtattagatattattatgccg
catctagacggacttgcggttttagagaggctgagggaatcagatctgaaaaaacagccg
aatgtcattatgctgacagcctttgggcaggaagatgtcacgaaaaaggccgtcgattta
ggcgcgtcctactttattctcaaaccgtttgatatggaaaaccttgtcggccatatccgc
caggtcagcggaaatgccagcagtgtgacgcatcgtgcgccatcatcgcaaagcagtatt
atacgcagcagccagcctgaaccaaagaagaaaaatctcgacgcgagcatcacaagcatt
atccatgaaatcggcgtcccagcccatattaaaggctatctctatctgcgcgaagcaatc
tcaatggtatacaatgacatcgaattgctcggcagcattacaaaagtcctctatccggac
atcgccaaaaaatttaacacaaccgcaagccgtgtagaaagagcgatccgccatgcaatt
gaagtggcatggagcagaggaaacattgattccatttcctcgttgtttggttatactgtc
agcatgacaaaagctaaacctaccaacagtgaattcattgcaatggttgcggataagctg
aggttagagcataaggcttcttaa

DBGET integrated database retrieval system