KEGG   Bacillus subtilis subsp. subtilis 168: BSU28540Help
Entry
BSU28540          CDS       T00010                                 

Gene name
ysiB
Definition
(RefSeq) enoyl-CoA hydratase
  KO
K13767  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00071  Fatty acid degradation
bsu00362  Benzoate degradation
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
bsu01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BSU28540 (ysiB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSU28540 (ysiB)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BSU28540 (ysiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 937448
NCBI-ProteinID: NP_390732
Pasteur: BG12331
BSORF: BG12331
UniProt: P94549
Position
complement(2917166..2917942)
Genome map
AA seq 258 aa AA seqDB search
MNAISLAVDQFVAVLTIHNPPANALSSRILEELSSCLDQCETDAGVRSIIIHGEGRFFSA
GADIKEFTSLKGNEDSSLLAERGQQLMERIESFPKPIIAAIHGAALGGGLELAMACHIRI
AAEDAKLGLPELNLGIIPGFAGTQRLPRYVGTAKALELIGSGEPISGKEALDLGLVSIGA
KDEAEVIEKAKALAAKFAEKSPQTLASLLELLYSNKVYSYEGSLKLEAKRFGEAFESEDA
KEGIQAFLEKRKPQFKGE
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaatttcacttgcggttgatcaatttgtggcagtcttgacgattcacaatccg
ccggcaaacgcgctttcaagccggatattagaagagctgtcttcctgtcttgatcaatgt
gagacagatgcaggcgtacgaagcattatcattcacggcgagggaagatttttctcagcc
ggcgctgatattaaagaatttacatcgcttaaaggcaatgaggattcctcattgctcgct
gagcgcggccagcagttaatggagagaatcgaaagttttccaaaaccgattatcgcagcg
attcacggcgctgctctcggaggcgggctggagcttgcaatggcctgtcacatcagaatc
gcggcagaagatgctaagctggggctcccggagcttaatctcggtatcattccaggtttt
gcggggacacagcgccttccgagatatgtcggtacagccaaagcactggagctcatcgga
tcaggagaaccgatatccggaaaagaagcgcttgatctcggacttgtctcaattggagcg
aaagatgaggcagaagtgattgaaaaagcaaaagcacttgccgctaagtttgcagagaaa
agcccgcaaacgctggcatctttgcttgaacttctttattccaacaaggtgtattcctat
gaaggcagcttaaagcttgaagcaaagcgatttggggaagcatttgagtcagaggacgcc
aaggaaggcatccaggcatttctcgaaaaaagaaagcctcagttcaaaggcgaataa

DBGET integrated database retrieval system