KEGG   Bos taurus (cow): 100137723Help
Entry
100137723         CDS       T01008                                 

Gene name
GTF2H4
Definition
general transcription factor IIH, polypeptide 4, 52kDa
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
bta  Bos taurus (cow)
Pathway
Basal transcription factors
Nucleotide excision repair
Viral carcinogenesis
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:bta03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:bta03420]
Human Diseases; Cancers; Viral carcinogenesis [PATH:bta05203]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
23
AA seq 463 aa AA seqDB search
MESTPSRGGLNRVHLQCRNLQEFLGGLSPGILDRLYGHPATCLAVFRELPSLAKNWVMRM
LFLEQPLPQAAVALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLR
IALLGGGKAWSDDTSQLGPDKHARDVLSLDKYAEERWEVVLHFMVGSPSAAVSQDLAQLL
SQAGLMKSAEPGEPPCITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQ
LSFSTLGKDYSVEGMSDSLLNFLQHLREFGLVFQRKRKSRRYYPTRLAINLSSGVSGAGG
TAHQPGFIVVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGI
TAQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFE
LLLAHARELGVLMFENSAKRLMVVTPAGHSDVKRFWKRQKHNS
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaccccttccaggggtggactgaatcgagtacacctacaatgcaggaacttg
caggaattcctaggaggcctgagccctggtatattggatcgattgtatgggcaccctgcc
acctgcctggctgtcttcagggagctcccatctttggctaagaactgggtgatgcggatg
ctctttctggagcagcctttgccgcaagctgctgtagccctgtgggtgaagaaggaattc
agcaaagctcaggaggaaagcacggggttgctgagcggcctccgtatctggcacacccag
ctactccctggtggtctccagggcctcatcctcaaccccatcttccgccaaaacctccgc
attgcccttctgggtgggggcaaggcctggtctgatgacacaagtcagctgggaccagac
aagcatgcccgggacgtcctctcacttgacaagtatgccgaggagcgatgggaggtggtc
ctgcacttcatggtgggatcccccagtgcagccgtcagccaggacttggctcagctcctc
agccaggctgggctcatgaagagtgccgaacctggagagccaccctgcattacctctgcc
ggcttccagttcctgttgctggacaccccagcccagctctggtactttatgttgcagtat
ctgcagacagcccagagtcggggcatggacctagtggagattctctccttcctcttccag
ctcagcttctccactctgggcaaggattactctgtggaaggtatgagtgattctctgttg
aacttcctgcaacatctgcgtgagtttgggcttgttttccagaggaagaggaaatctcgg
cgttactaccccacacgcctggccatcaatctctcgtcaggtgtttctggggctgggggc
actgcacatcagccaggcttcattgttgtggaaaccaattaccgactgtatgcctacacg
gagtcggagctgcagatcgccctcattgcccttttctctgagatgctctatcgcttcccc
aacatggtggtggcacaggtgacccgggagagcgtgcagcaggccattgccagtggcatc
acagcccagcagatcatccatttcctaaggacaagggcccacccagtgatgcttaaacag
acaccggtgctgcctcccaccatcacagaccagattcggctctgggagctggaaagggac
aggctccggttcaccgaaggcgtcctgtataaccagttcctgtcacaagtggactttgag
ctgctgctggcccacgcgcgggagctgggcgtcctgatgttcgagaactcggccaagcgg
ctcatggtggtgaccccggctgggcacagcgacgtcaagcgcttctggaagcggcagaaa
cacaactcctga

DBGET integrated database retrieval system