KEGG   Bos taurus (cow): 281991Help
Entry
281991            CDS       T01008                                 

Gene name
POLD2
Definition
polymerase (DNA directed), delta 2, regulatory subunit 50kDa (EC:2.7.7.7)
Orthology
K02328  
DNA polymerase delta subunit 2
Organism
bta  Bos taurus (cow)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
HTLV-I infection
Module
DNA polymerase delta complex
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bta00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bta00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:bta03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bta03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:bta03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:bta03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bta03440]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:bta05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
4
AA seq 469 aa AA seqDB search
MFSEQAAQRAHTLLSPPSASNATFARVPVVTYTNSSQPFRLGERSFSRQYAHIYATRLIQ
MRPFLVSRAQQRWGSGVLVKKLCELQPGEKCCVVGTLFKAMPLQPSILREVSEEHNLLPQ
PPRSKYIHPDDELILEDELQRIKLEGTIDVSKLVTGTVLAVLGSAGDDGKFLVEDHCFAG
LAPQKPACPLDTDRFVLLVSGLGLGGGGGESLLGTQLLVDVVTGQLGDEGEQCSAAHVSR
VILAGNLLSHNTQSRDSINKAKYLTKKTQAASVEAVKMLDEILLQLSASVPVDVMPGEFD
PTNYTLPQQPLHPCMFPLATAYSTLQLVTNPYQATIDGVRFLGTSGQNVSDIFRYSSMED
HLEILEWTLQVRHISPTAPDTLGCYPFYKTDPFIFPECPHVYFCGNTPSFGSKIIQGPED
QTVLLVAVPDFSTTQTACLVNLRSLACQPISFSGFGAEDEDLGGLGLGP
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgttttctgagcaggctgcccagagggcccacactctgctgtctccgccatcagccagc
aatgccacttttgccagggtgcctgtggtgacttacaccaattcctcgcagcccttccgg
ctgggagagcgcagctttagccggcagtatgcccacatttatgccacccgtctcatccag
atgaggcccttcctggtgagcagggcccagcagcgctggggcagtggagtcctagtgaag
aagctgtgtgaactgcagcccggggagaagtgctgtgtggtggggaccctcttcaaggcc
atgccactccagccctccatcctacgggaggtcagcgaagagcacaacctgctcccccag
cctcctcggagcaaatacatccacccagatgatgaactgatcttggaagatgaattgcag
cgtatcaaactggagggcaccattgatgtgtcaaagctggtcacaggaacggtcctggct
gtgctgggctctgcaggagatgatggaaagttcctggtggaggaccactgctttgcaggg
cttgcccctcagaagcctgcatgccccctcgacacagacaggtttgtgctgctggtgtct
ggtctgggcctgggtggaggcgggggcgagagcctgctgggcacccagctgctggtggac
gtggtgacagggcagcttggggatgaaggggagcagtgcagtgccgcccacgtctcccgg
gtcatccttgccgggaacctcctcagccacaacacgcagagcagagactccatcaacaag
gccaagtacttgaccaagaaaacccaggctgccagtgtggaggctgtcaagatgctggac
gaaatccttctgcagctgagcgcctccgtgcccgtggatgtgatgccaggcgaatttgac
ccaacaaactacacgcttccccagcagcccctgcacccctgcatgttccctctggccact
gcctactccacgctccagctggtcaccaacccctaccaggccaccatcgatggagtcaga
ttcctggggacgtcgggacagaacgtgagtgacatcttccgatacagcagcatggaggat
cacttggagatcctggagtggacgctgcaagtccggcacatcagccccacagcccctgac
accctaggttgttaccctttctataaaaccgacccatttatctttccggagtgccctcac
gtctacttttgtggcaacacccccagctttggctctaaaatcatccaaggccccgaagac
cagacagtgttgttggtggctgtcccagacttcagcaccacccagaccgcctgtctcgtg
aacctgcgcagcctggcctgccagcccatcagcttctcaggcttcggggcagaggatgaa
gacctgggaggcctgggtctgggtccctga

DBGET integrated database retrieval system