KEGG   Bos taurus (cow): 282110Help
Entry
282110            CDS       T01008                                 

Gene name
UCHL5, UCH37
Definition
(RefSeq) ubiquitin C-terminal hydrolase L5
  KO
K05610  ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
bta  Bos taurus (cow)
Brite
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     282110 (UCHL5)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   282110 (UCHL5)
Ubiquitin system [BR:bta04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    282110 (UCHL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C12
Motif
Other DBs
NCBI-GeneID: 282110
NCBI-ProteinID: NP_776906
BGD-bta: BT13331
Ensembl: ENSBTAG00000013620
UniProt: Q9XSJ0
Position
16
AA seq 328 aa AA seqDB search
MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQP
GEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQS
FDAAMKGLALSNSDVIRQVHNSFARQQMFEFDAKTAAKEEDAFHFVSYVPVNGRLYELDG
LREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQR
QLAEEPMDTDQGSNMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLK
TLAEHKQLIPLVEKAKEKQNAKKAQETK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacgggcaatgccggggagtggtgcctcatggagagcgaccccggggtcttcaccgag
ctcattaaaggatttggttgccgaggagcccaagtagaagaaatatggagtttagagccc
gagaattttgaaaaattaaagccagttcatgggttgatttttcttttcaagtggcaacca
ggagaagaaccagcaggctctgtggttcaggactccagactggacacaatcttttttgcc
aagcaggtaattaataatgcttgtgctactcaagccatagtaagtgtgttattgaactgc
acgcatcaagatgtccatttaggagagacattatcagagtttaaagaattttcacaaagt
ttcgatgcagctatgaaaggtttggcgctgagtaattcagatgtcatccgacaagtgcac
aacagttttgccagacagcaaatgtttgaatttgatgctaagacagcagcaaaagaagaa
gatgcttttcactttgtcagttacgttcctgttaatggaagactgtatgaactagatgga
ttaagagaaggaccgattgacttaggtgcatgcaatcaagatgactggatcagcgcagtg
aggccagtcatagaaaaaaggatacaaaagtacagtgaaggtgaaattcgatttaactta
atggctattgtgtctgacagaaaaatgatatatgaacagaagatagcagagttacaaaga
caacttgctgaggaacccatggatacagatcagggcagtaatatgttaagtgctattcag
tcagaggttgccaaaaatcagatgcttattgaagaggaagtacagaaattaaaaagatat
aagattgaaaatatcagaaggaagcacaattatctgccattcattatggaattgttaaag
actttagcagaacacaagcagttaataccactagtagaaaaggcaaaagaaaagcagaat
gcaaagaaagcacaggaaaccaaatga

DBGET integrated database retrieval system