KEGG   Bos taurus (cow): 282183Help
Entry
282183            CDS       T01008                                 

Gene name
AP2B1, CLAPB1
Definition
(RefSeq) adaptor-related protein complex 2, beta 1 subunit
  KO
K11825  
AP-2 complex subunit beta-1
Organism
bta  Bos taurus (cow)
Pathway
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Brite
KEGG Orthology (KO) [BR:bta00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    282183 (AP2B1)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    282183 (AP2B1)
  Nervous system
   04721 Synaptic vesicle cycle
    282183 (AP2B1)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    282183 (AP2B1)
Membrane trafficking [BR:bta04131]
 Endocytosis
  Clathrin-mediated endocytosis
   AP-2 complex
    282183 (AP2B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
19
AA seq 951 aa AA seqDB search
MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQT
DNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITE
YLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANA
VAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSI
CERVTPRLSHANSAVVLSAVKVLMKFLELLPKESDYYNMLLKKLAPPLVTLLSGEPEVQY
VALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKE
YATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRK
YPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQV
QLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEV
VLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGST
DAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGL
DSLLGSDLGGGIGGSPAVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGG
YVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIP
STPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLF
VEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDM
LYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgactgactctaagtacttcacaaccaataaaaaaggagaaatctttgaattaaaggct
gaactcaacaatgaaaagaaagaaaagaggaaggaggctgtgaagaaagtgattgctgct
atgactgtggggaaagacgttagctctctctttccagatgtagtgaactgtatgcagacg
gataatctggaactgaagaagcttgtgtatctctacttgatgaactatgccaagagtcag
ccagacatggccatcatggctgtcaacagctttgtgaaggattgtgaagatcccaatcct
ctgattcgagctttggcagtcagaaccatggggtgcatccgggtggacaagataacagag
tatctctgtgagcccctccgcaagtgcttaaaggatgaagatccctacgtccggaagaca
gcagcagtctgcgtggcaaaactccatgacatcaatgcccagatggtggaagatcaggga
tttctggattctctgcgggatctcatagcagattcaaatccaatggtggtggctaatgct
gtagcagcactatctgaaatcagtgaatctcaccccaacagcaacttactcgatctgaat
ccacagaacattaataagctactgacagccctgaatgagtgcaccgaatggggccagatt
ttcatcctggactgcttatctaattacaatcctaaagatgaccgggaggctcagagcatc
tgtgagcgggtaactccccggttatctcatgccaactcagcagtggtgctttcagcagta
aaagtcctaatgaaatttttagagttgctacccaaggagtctgactactacaatatgctg
ctgaagaagttggcccctccacttgtcactttgctgtctggggagccagaggtgcagtac
gtcgccctgaggaacatcaacctaattgttcagaaaaggcctgaaatcttgaagcaggaa
ataaaagttttctttgtgaagtacaatgatcccatctatgtgaaactagagaagttggac
atcatgattcgtttggcatcccaagccaacattgctcaggttctggctgaactgaaagag
tatgccacagaggtggatgttgactttgtgcgcaaagctgtgcgagccattgggcggtgt
gccatcaaggtggagcaatctgcagagcgctgtgtgagcacgttgcttgatctcatccaa
accaaagtaaattatgtggtccaagaggcgattgttgtcatcagggacattttccgcaaa
tatcccaacaaatacgaaagtatcattgccacactgtgtgagaacttagattctctggat
gagccagacgctcgagcagctatgatttggattgtgggagaatatgctgaaagaattgac
aatgccgatgagttactagagagcttcctggagggttttcatgatgaaagcacgcaagtg
cagctcactctgctcactgccatagtgaagctgtttctcaagaaaccgtcagaaacacag
gagctggtacagcaggtcttgagtttggcaacacaggattctgataatcctgaccttcga
gaccggggctatatttattggcgccttctctcaactgatcctgtcacagctaaagaagta
gtcttgtctgaaaagccactgatttctgaggagacagatcttattgagccaactctactg
gatgagctaatctgccacattggttctttggcctcagtgtaccataagccgcccaatgct
tttgtggaaggaagtcatggaatccatcgcaaacacttgccaatacatcatgggagcact
gatgcaggagacagccctgtgggcacaaccactgccaccaacctggagcagcctcaggtt
attccctcccagggtgaccttctgggggatcttttaaaccttgaccttggtcccccagtc
aatgtgccacaggtatcttccatgcagatgggagcagtggatctcttgggaggaggccta
gatagtctgcttggcagtgaccttggcgggggcattggaggaagtccggcagtgggacag
tccttcatcccatcatcagtgcctgcaacctttgctccctcccctactcctgctgtggtc
agcagtggtctgaatgacctgtttgaactctccacggggataggcatggcacctggtgga
tatgtggctcctaaggctgtctggctgcctgcagtaaaggctaaaggcctggagatttca
ggaacatttactcaccgccaagggcatatctatatggaaatgaacttcaccaacaaagct
ctacagcacatgacagacttcgcaattcagtttaacaagaatagctttggtgtcatccct
agcactcctctggccatccatacaccactgatgccaaaccagagcattgatgtctccctg
cccctcaacaccttgggccctgtcatgaagatggagcctctgaacaacctgcaggtggct
gtgaaaaacaatattgatgtcttctacttcagctgcctcatcccactcaacgtgcttttt
gtagaagatggcaaaatggagcgccaggtcttccttgcaacatggaaggatattcccaat
gaaaatgagcttcagtttcagattaaggaatgtcatttaaatgctgacactgtttccagc
aagttgcaaaacaacaatgtttatactattgccaagaggaatgtggaagggcaggacatg
ctgtaccaatccctgaagctcactaacggcatttggattttggccgagctacgtatccaa
ccaggaaaccccaattacacgctgtcactgaagtgtagagctcccgaggtctcccagtac
atctatcaggtctacgacagcattttgaaaaactaa

DBGET integrated database retrieval system