KEGG   Bos taurus (cow): 513057Help
Entry
513057            CDS       T01008                                 

Gene name
PLCD3
Definition
phospholipase C, delta 3 (EC:3.1.4.11)
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
bta  Bos taurus (cow)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    513057 (PLCD3)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    513057 (PLCD3)
   04070 Phosphatidylinositol signaling system
    513057 (PLCD3)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    513057 (PLCD3)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     513057 (PLCD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
19
AA seq 815 aa AA seqDB search
MLCGSWRSRRRQPEEPLVPAQVATPVGLASPPASQEGNIKRPGLRALKKMGLSEDEDVRA
MLRGSRFCKIRSPTWQKERLYRLQEDGLSVWFQRRIPRAPSQHIFFVQHIEAIREGHQSE
GLRHFGGAFEPARCLTIAFKGRRKNLDLVAPTAEEAQRWVRGLAKLRARLDAMSQRERLD
HWIHSYLHRADSNQDSKMSFKEIKNLLRMVNLDMNDMYAYGLFKECDRSKNERLEGPEIE
EFLRRLLKRPELEEIFHRYSGEDRVLSASELLEFLEDQGEHKATLAHAQQLIHTYELNET
AKQHELMTLDGFMMYLLSPEGAALDLAHTRVFQDMDQPLAHYFISSSHNTYLTDSQIGGP
SSTEAYVRAFAQGCRCVELDCWEGPGGEPVIYHGHTLTSKILFRDVIQAVREHAFTVSPY
PVILSLENHCGLEQQAAMARHLHTILGDMLVTQTLDSQNPEELPSPERLKGRVLVKGKKL
PDTRSENGCILSEREEEDEEEDEEEELGAVEQRRRAKQISPELSALAVYCCATRLRTLRP
PPVPPQPCQVSSLSERKAKKLIREAGNSFVRHNARHLTRVYPLGLRMNSANYSPQEMWNS
GCQLVALNFQTPGYEMDLNAGRFLVNGQCGYILKPVRLRSPNTTFDPECPGPPRTTLTIQ
VLTAQQLPKLNTEKPNSIVDPLVRIEIHGVPADCARKKTNYVLNNGFNPRWGQTLEFQLR
VPELALVRFVVEDYDATSPNDFVGQFTLPLSSLKQGYRHIHLLSKDGASLSPATLFVHIC
IRSRATLGSAGASLCPTPALRSGGRDGGPAPPSSR
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgcggtagctggaggagccgccggcggcagcccgaggagcccctggtcccagcc
caggtcgcaacgcccgtagggctcgcgtccccgcccgcatcccaggaaggcaacatcaag
aggcccgggctgcgggcgctgaagaagatgggcctgtcggaggatgaggatgtgcgggcc
atgctgcggggctcccgcttctgcaagatccgctcgccgacgtggcagaaggaacggctg
taccggttgcaggaggatggcctgagcgtgtggttccagcggcgcatcccgcgtgcgcct
tcgcagcacatcttcttcgtccagcacatcgaggccatccgcgagggccaccagtccgag
ggcctgcggcacttcgggggcgcctttgagccggcacgctgcctcaccatcgctttcaag
gggcgccgcaagaacttggacctggtggcgcccacggccgaggaggcgcagcgctgggtg
cgtggtctggccaagctgcgcgcgcgcctcgatgccatgagccaacgcgagcgccttgac
cactggatccactcctatctgcaccgggcagactccaaccaggacagtaagatgagcttc
aaggaaatcaagaacctgctccgcatggtcaacttggacatgaacgacatgtacgcctac
ggcctcttcaaggagtgtgaccgctccaaaaatgagcggctggaggggccagagatcgag
gaatttctgcggcggctgctgaaacgccctgagttggaggagatcttccatcggtactca
ggagaggaccgcgtgctgagcgcctctgagctgctggagttcctggaggaccagggcgag
cacaaggccacactggcccacgcccagcagctcatccacacctatgagctcaacgagaca
gccaagcagcatgagctgatgacactggatggcttcatgatgtacctgctgtcccctgag
ggagctgccctggacctggcccacacacgcgtgttccaggacatggaccagcccctcgcc
cactacttcatctcctcctcacacaacacctacctgactgactctcagatcgggggaccc
agcagtactgaggcctacgtcagggcctttgcccagggatgccgctgtgtggagctggac
tgctgggaggggccaggaggtgagccggtcatctatcacggccacaccctcacctccaag
atcctcttccgagacgtgatccaggcagtgcgagagcacgccttcacggtgtccccgtac
cccgtcatcctatcccttgagaaccactgcgggctggagcagcaggctgccatggcccgc
cacctgcacaccatcctgggggacatgctggtgacacagacactggactcccagaatcct
gaggagctgccatccccagagaggctgaaaggccgggtcttggtgaaggggaagaagctg
ccagacactaggagtgagaacggttgcatcctatcagagcgggaggaggaggatgaagag
gaagatgaagaggaggaattgggggccgtagagcagaggcggcgggccaagcagatctcc
ccggagctgtcggccctggccgtgtactgctgtgccacccgcctgcggaccctgcgcccg
cccccggtcccgccccagccctgccaggtcagctccctcagcgagcgcaaggccaagaag
ctcatccgagaggcagggaacagcttcgtcaggcacaatgcccgccacctgacacgtgtc
tacccgctggggctgcggatgaactcggccaactacagcccccaggagatgtggaactcg
ggctgtcagctggtggcgctgaacttccagacaccgggttacgagatggacctcaatgct
gggcgcttcctcgtcaacgggcagtgtggctacatcctgaaacccgtccgtctgcggtcg
cccaacacaacctttgaccctgagtgtcctgggccccccagaacgactctcaccatccag
gtgctgacggcacagcagctgcccaagctgaacaccgagaagcccaattccattgtggac
ccgctggtgcgcattgagatccacggggtgcccgcggactgtgctcgcaagaagaccaac
tatgtgctcaacaacggcttcaacccccgctgggggcagaccctggagttccagttgcgg
gttccggagctggcgttggtccggttcgtggtagaggattatgacgccacctcccccaat
gacttcgtgggccagttcacgctgcctctcagcagtctgaagcaagggtaccgccacatc
cacctgctttctaaggacggggcctcactgtcaccggccactctctttgtccacatctgc
atccggagccgagccaccctgggttctgcaggtgccagtctgtgtcccacgcccgccctc
cggagtggagggcgtgatggaggaccagcccctccatcctcccgctga

DBGET integrated database retrieval system