KEGG   Bos taurus (cow): 514587Help
Entry
514587            CDS       T01008                                 

Gene name
USP19
Definition
ubiquitin specific peptidase 19
Orthology
K11847  
ubiquitin carboxyl-terminal hydrolase 19 [EC:3.1.2.15]
Organism
bta  Bos taurus (cow)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
Position
22
AA seq 1340 aa AA seqDB search
MSGGASATGPRRGPPGLEEATSKKKQKDRANQESKDGDPRRGGSAFTPREEQTKEEAHRD
PHNLLVTPCIDLGLDWRQSADEVIVKLRVGTGPLRLEEVDAAFTDTDCVLRLPDGRQWGG
VFYAEIESSCTKVQARKGGLLQLSLPKKVPLLTWPSLLKKPLGTQELVPGLRCQENGQEP
SPVALEPGPEPRRAKQEARNQKRAQGRGEVGAGAGPGAQAGPSAKRAVHLRRGPEGEGPR
DGPGPRGDAPQFLAEPATQAEAEEQLRVPPLTPQTCLLGSEENLALLTGKKAAAPRSDPV
SPTVARSRDPEKDDCSKEEMAVATDAAALVDEPESTVNLAFVKNDSYEKGPDSVVVHVYV
KEIRRDTSRVLFREQDFTLIFQTRDGNFLRLHPGCGPHTIFRWQVKLRNLIEPEQCTFCF
TASRIDICLRKRQSQRWGGLEAPAARGAVGGAKVAVPTGPSPLDSAPPGGTPHPLTGQEE
ARAVEKEKPKARSEDTGLDGVATRTPVEHVAPKSEPHLASPKPTCMVPPMPHSPVSGDSV
EEEEEEEKKVCLPGFTGLVNLGNTCFMNSVIQSLSNTRELRDFFHDRSFEAEINYNNPLG
TGGRLAIGFAVLLRALWKGTHHAFQPSKLKAIVASKASQFTGYAQHDAQEFMAFLLDGLH
EDLNRIQNKPYTETVDSDGRPDEVVAEEAWQRHKMRNDSFIVDLFQGQYKSKLVCPVCAK
VSITFDPFLYLPVPLPQKQKVLPVFYFAREPHSKPIKFLVSVSKENSSASEVLDSLSQSV
HVKPENLRLAEVIKNRFHRVFLPSHSLDTVSPSDTLLCFELLSPELAKERVVVLEVQQRP
QVPSIPISKCAACQRKQQSEDEKLKRCTRCYRVGYCNQLCQKTHWPDHKGLCRPENIGYP
FLVSVPASRLTYARLAQLLEGYARYSVSVFQPPFQPGRMALESQGPGCTTLLSTSSLEAG
DSDRDPIQPPELQLVTPVAEGDTGASRAWASPDRGPVPSTSGISSEMVASGPVEVGALTV
GERVSRPEAAVPGYQHPSEALSAHTPQFFIYRIDASNREQRLEDKGDVPLDLGDDCSLAL
VWRNNERLQEFVLVASKELECAEDPGSAGEAARAGHFTLDQCLNLFTRPEVLAPEEAWYC
PQCKQHREASKQLLLWRLPNVLIVQLKRFSFRSFIWRDKINDLVEFPVRNLDLGKFCIGQ
KEEQLPSYDLYAVINHYGGMIGGHYTACARLPNDRSSQRSDVGWRLFDDSTVTTVDESQV
VTRYAYVLFYRRRNSPVERPPRAGHSEHHPDLGPAAESAASQGLGPGQAPEVAPTRTAPE
RFAPPVDRPAPTYSNMEEVD
NT seq 4023 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtggggccagcgctacaggcccaaggagagggcccccaggactggaggaggca
accagtaagaaaaagcagaaggatcgagcaaaccaggagagcaaagacggcgatcctagg
agaggtgggagtgcattcactcctcgggaggagcagaccaaagaggaagctcaccgagac
cctcacaatcttttggtcactccctgtatagacttagggctcgattggaggcagagtgct
gatgaggtgattgtcaagctgcgcgtgggaaccggtcccctgcggctggaggaagttgac
gctgctttcacagacacggactgtgtgctgcggctcccagatggtcggcagtggggtggt
gttttctatgccgagatagagagttcttgcaccaaagtgcaggctcgcaaaggtggcctc
ctgcagctgtcactgcccaagaaggtgcctctgcttacgtggccctctctgctgaagaaa
cctctagggacccaggagttggtgccagggttgcggtgccaggagaatgggcaggagcca
tctcccgttgccctggagccaggccctgagccccggcgggctaagcaggaggcccgcaac
cagaagcgggcccagggccgtggtgaggtaggcgctggggctggtcctggggcccaggca
gggcccagcgccaagagggccgtgcatctccgcagagggccagagggggaagggcccaga
gatggccctgggcctcggggtgatgccccccaattcctggctgagccggccacccaggct
gaggctgaggaacagctccgtgtaccaccactgaccccccagacctgcctcctgggctca
gaggagaatctagcacttttgacaggaaagaaggcagcagcccccaggagcgacccagtg
tcccctaccgtggctcggagcagagaccctgagaaggacgattgttccaaggaggagatg
gcagtggccacagatgctgcggccttggtggatgagcccgagtccacggtgaacctggca
tttgtcaagaatgattcgtacgagaaggggccggactcagtggtggtgcacgtgtatgtg
aaggaaatccgcagggacacctctcgagtgctcttccgtgagcaggacttcacgcttatc
ttccagaccagggacggaaacttcctgagactgcatccgggctgtggaccccacaccatc
ttccgttggcaggtgaagctcaggaacctgatcgagcccgagcagtgcaccttctgcttc
acggcctcgcgcatcgacatctgcctccgcaagcggcagagccagcgctgggggggcctg
gaggccccggctgcacgaggtgcagtgggtggtgcaaaggtcgccgtgccgacaggtcca
tcccccctggattcagccccaccgggaggtacaccccatcccttgacaggccaggaggaa
gcccgggccgtggagaaggagaaacccaaggctcgatctgaggacacaggcctcgatggg
gtggccacccgcacccccgtggagcatgtagccccaaagtcagagccacacctggcgtcg
cccaagcccacatgtatggtgcctccaatgccccacagcccggtgagtggagacagcgtg
gaggaagaagaggaggaagagaagaaggtgtgtctgccaggcttcaccggcctcgtcaac
ttaggcaacacctgcttcatgaacagtgtcattcagtctctgtccaacacgcgggagctg
cgggacttcttccatgaccgctccttcgaggctgagatcaactacaacaacccgctgggg
actggtgggcgtctggccatcggctttgctgtgctgctccgggcgctgtggaagggcacc
caccatgccttccagccctccaagttgaaggccatcgtggcgagcaaggccagccagttc
acaggctacgcccagcacgatgcccaggagttcatggctttcctgctggatgggctgcac
gaggacttgaaccgcattcagaataagccctacacggagactgtggactcagatgggcgg
cctgatgaggtggtggctgaggaagcctggcagcggcacaagatgaggaacgactctttc
atcgtggacctgtttcagggccagtacaagtcgaagctggtgtgccccgtgtgtgcaaag
gtctccatcacttttgacccgttcctgtacctgccagtgcccttgccccagaagcaaaag
gttctccctgtcttctatttcgcccgggagccccacagcaagcccatcaagtttctggtg
agcgtcagcaaagagaactccagtgcgagcgaagtgttggactccctatctcagagtgtc
catgtgaagcctgagaacctgcgtctggctgaggtgattaagaatcgcttccaccgtgtg
ttcctgccctcccactcactggacaccgtgtccccgtccgacacactcctctgcttcgag
ttgctgtccccagagttggccaaggagagggtggtggtgctagaggtacaacagcgcccc
caggtgcccagcatccccatctccaagtgtgcagcctgccagcggaagcagcagtcagag
gacgagaagctgaagcgctgtacccggtgctaccgcgtgggctactgcaaccagctctgt
cagaaaacccactggcctgaccacaagggcctctgccgccccgagaacattggctacccc
ttcctggtcagtgtccccgcctcgcgcctcacctacgcccgtcttgctcagctgctagag
ggctatgcccggtactctgtgagtgtgttccagccgcccttccagcccggccgcatggcc
ttggagtcccagggccctggctgcaccacgctactctccactagctccctggaggccggg
gacagtgacagggaccccattcagccaccagagctccagttggtgacccctgtggctgag
ggggacactggggcctcccgggcatgggcatcccctgatcggggccctgtgcccagcacc
agcggcatttcttctgagatggtggccagtgggcctgttgaagttggcgccttgactgtt
ggtgagagggtgtcccggcctgaagctgctgtgcccgggtaccaacacccaagtgaagcc
ctgagtgcccacactccacagttcttcatctacagaattgatgcgtccaaccgagagcag
cggctagaggacaaaggagacgtcccactggacctgggagacgactgcagcctggccctg
gtctggcgcaacaacgagcgcctgcaggagttcgtgctggtggcctccaaggagctggag
tgcgccgaggaccctgggtctgccggtgaggctgcccgtgccggccacttcacgctggac
cagtgcctcaacctcttcacacggccggaggtgttggcacccgaggaggcttggtactgc
ccgcagtgcaaacagcaccgcgaggcctccaagcagctgctgctgtggcgcctgcccaac
gtgctcatcgtgcagctcaagcgcttctccttccgcagcttcatctggcgtgacaagatc
aacgacctggtggagtttcccgtccggaacctggacctgggcaagttctgtatcggtcag
aaagaggagcagctgcccagctacgacctgtacgccgtcatcaaccactacgggggcatg
atcggcggccactacaccgcctgcgcacgcctgcccaatgaccgcagcagccagcgcagc
gacgtgggctggcgcctgttcgacgacagcacggtgacaacggtagacgagagccaggtg
gtgacgcgttatgcctatgtcctcttctaccgccggcggaactctcccgtggagaggccc
ccccgggcaggtcactctgagcaccaccctgatctgggccctgcagctgagtcagctgcc
agccagggactaggccctggccaggcccccgaggtggcccccacgcggacagcccctgaa
cgcttcgccccccctgtggaccgcccagcccccacctacagcaacatggaggaggtcgat
tag

DBGET integrated database retrieval system