KEGG   Bos taurus (cow): 516190Help
Entry
516190            CDS       T01008                                 

Gene name
GSTT2, GSTT3
Definition
(RefSeq) glutathione S-transferase theta 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bta  Bos taurus (cow)
Pathway
bta00480  Glutathione metabolism
bta00980  Metabolism of xenobiotics by cytochrome P450
bta00982  Drug metabolism - cytochrome P450
bta00983  Drug metabolism - other enzymes
bta01524  Platinum drug resistance
bta05200  Pathways in cancer
bta05204  Chemical carcinogenesis
bta05225  Hepatocellular carcinoma
bta05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    516190 (GSTT2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    516190 (GSTT2)
   00982 Drug metabolism - cytochrome P450
    516190 (GSTT2)
   00983 Drug metabolism - other enzymes
    516190 (GSTT2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    516190 (GSTT2)
   05204 Chemical carcinogenesis
    516190 (GSTT2)
   05225 Hepatocellular carcinoma
    516190 (GSTT2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    516190 (GSTT2)
  Drug resistance
   01524 Platinum drug resistance
    516190 (GSTT2)
Enzymes [BR:bta01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     516190 (GSTT2)
Transporters [BR:bta02000]
 Other Transporters
  Pores ion channels [TC:1]
   516190 (GSTT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_2 GST_C_3 GST_N_4 Tom37
Motif
Other DBs
NCBI-GeneID: 516190
NCBI-ProteinID: NP_001069206
BGD-bta: BT23938
Ensembl: ENSBTAG00000008587
UniProt: Q0VCS8
Position
17
AA seq 239 aa AA seqDB search
MGLELYLDLLSQPCRAVYIFAKKNSIPFELRTVDLLKGQNHSDDFVQVNPLRKVPALKDG
DFTLAESVAILLYLARKYEAPDHWYPQDLQARARVDEYLSWQHTALRTSCTRTMWQKMMF
PIFLGQRVPPETLANTLAELDRCLQLLEDKFLKDQDFLAGPHISVADLVAITELMHPVSA
GCDIFKSRPKLAAWRQRVEAAVGEDLFREAHAVLMKAKDLPPADTAMKERLKPLAQLFL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgggcctggagctctacctggacctgctgtcccagccctgccgcgccgtctacatcttc
gccaagaagaacagcatcccctttgagctgcgcaccgtggacctgctcaaaggccagaac
cacagcgatgactttgtccaggtgaaccccctgaggaaggtgccagccctgaaagatggg
gacttcaccttggctgagagtgtggccatcctgctgtatctggcccgcaagtacgaggcc
cctgaccactggtacccccaggacctgcaggcccgagcccgcgtggacgagtacctgtcg
tggcagcacacggccctccggacgagctgcacccggacaatgtggcagaagatgatgttc
cccatattcctgggccaacgcgtgccccctgagacactggcgaacactctggccgaactg
gacaggtgcctgcaactgctcgaggacaagttcctgaaggaccaggacttcctggctggg
ccccacatctcagtggcggacttggtggccatcacagagctgatgcatcccgtcagcgcc
ggttgtgacatcttcaaaagccggcctaagctggccgcatggcgccagcgcgtggaagct
gcagtgggggaggacctcttccgagaggcccatgcggtcctcatgaaggccaaggacctg
cctccagcagacactgccatgaaggagaggctgaagcccttagcgcagctgttcttgtag

DBGET integrated database retrieval system