KEGG   Bos taurus (cow): 516190Help
Entry
516190            CDS       T01008                                 

Gene name
GSTT2, GSTT3
Definition
(RefSeq) glutathione S-transferase theta 2
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bta  Bos taurus (cow)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Chemical carcinogenesis
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    516190 (GSTT2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    516190 (GSTT2)
   00982 Drug metabolism - cytochrome P450
    516190 (GSTT2)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    516190 (GSTT2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    516190 (GSTT2)
  Drug resistance
   01524 Platinum drug resistance
    516190 (GSTT2)
Enzymes [BR:bta01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     516190 (GSTT2)
Transporters [BR:bta02000]
 Other Transporters
  Pores ion channels [TC:1]
   516190 (GSTT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
17
AA seq 239 aa AA seqDB search
MGLELYLDLLSQPCRAVYIFAKKNSIPFELRTVDLLKGQNHSDDFVQVNPLRKVPALKDG
DFTLAESVAILLYLARKYEAPDHWYPQDLQARARVDEYLSWQHTALRTSCTRTMWQKMMF
PIFLGQRVPPETLANTLAELDRCLQLLEDKFLKDQDFLAGPHISVADLVAITELMHPVSA
GCDIFKSRPKLAAWRQRVEAAVGEDLFREAHAVLMKAKDLPPADTAMKERLKPLAQLFL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgggcctggagctctacctggacctgctgtcccagccctgccgcgccgtctacatcttc
gccaagaagaacagcatcccctttgagctgcgcaccgtggacctgctcaaaggccagaac
cacagcgatgactttgtccaggtgaaccccctgaggaaggtgccagccctgaaagatggg
gacttcaccttggctgagagtgtggccatcctgctgtatctggcccgcaagtacgaggcc
cctgaccactggtacccccaggacctgcaggcccgagcccgcgtggacgagtacctgtcg
tggcagcacacggccctccggacgagctgcacccggacaatgtggcagaagatgatgttc
cccatattcctgggccaacgcgtgccccctgagacactggcgaacactctggccgaactg
gacaggtgcctgcaactgctcgaggacaagttcctgaaggaccaggacttcctggctggg
ccccacatctcagtggcggacttggtggccatcacagagctgatgcatcccgtcagcgcc
ggttgtgacatcttcaaaagccggcctaagctggccgcatggcgccagcgcgtggaagct
gcagtgggggaggacctcttccgagaggcccatgcggtcctcatgaaggccaaggacctg
cctccagcagacactgccatgaaggagaggctgaagcccttagcgcagctgttcttgtag

DBGET integrated database retrieval system