KEGG   Bos taurus (cow): 525346Help
Entry
525346            CDS       T01008                                 

Gene name
NCOA1
Definition
nuclear receptor coactivator 1 (EC:2.3.1.48)
Orthology
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
bta  Bos taurus (cow)
Pathway
Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    525346 (NCOA1)
Enzymes [BR:bta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     525346 (NCOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
11
AA seq 1441 aa AA seqDB search
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDEVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRQNSHTFNCRMLIHRPDEPGPENQEACQRYEVMQCFTVSQPKSIQEDGEDFQ
SCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDTNPGMSVPRVNPSVNPSISPAHGVARSSTLPPSNSNMVPTRVNR
QQSSDLHSSSHSNSSNSQGSFGCSPGNQIVASVALNQGQASSQSTNPPLNLNNSPMEGTG
ISLAQFMSPRRQVSSGLATRPRMPNNSFPPNIPTLSSPVSMTSTACNNSNRSYSNIPVTP
LQSMNEGPNNSVGFSASSPVLRQMSSQNSPSRLNIQPAKAESKDNKEIASILNEMIQSDN
SSNDSKPLDSGLLHNNDRLSDGDNKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKEVLSC
TGTSTSASTNSSSGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASTSVS
VTGQVQGNSSVKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKEQ
MDPCNTNPASMTKPAPEEIKLESQSQFTADLDQFDQLLPTLEKAPQLPGLCETERMDGAV
SNVAIKSEILPSALQSTSARPTSRLNRLPELELEAIDNQFGQPGTGDQIPWANNTVTAVN
QNKPEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKL
VQGGGLDVLSERFPPQQATPPLMMEERPNLYSQPYSSPSPTANLSSPFQGMVRQKPSLGT
MPVQVTPPRGAFSPGMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLIHQNRQAILNQF
AANAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQSF
GNSLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEAPLAN
RSSMVNRGMTGNMGGQFGTGINPQMQQNVFQYPGSGMVPQGEANFAPSLSPGSSMVPMPI
PPPQSSLLQQTPPTSGYQSPDMKAWQQGAMGNNNVFSQAIQNQPTPAQPGVYNNMSITVS
MAGGNTNVQNMNPMMGQMQMSSLQMPGMSTVCPEQINDPALRHTGLYCNQLSSTDLLKTE
ADGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTAGPQTPQAQQKSLLQQLLT
E
NT seq 4326 nt NT seq  +upstreamnt  +downstreamnt
atgagtggccttggggacagttcatctgaccctgctaacccagactcacataagagaaaa
gggtcaccatgtgacacactggcatcaagcactgaaaagaggcgcagggagcaagaaaat
aaatatttggaagagctagctgagttattgtctgccaacatcagtgacattgacagctta
agtgtaaaaccagacaaatgcaagatattgaagaagacagtcgatcagatacaactaatg
aagagaatggaacaagagaaatcaacaactgatgatgaagtacagaagtcagacatctca
tcaagcagtcaaggagtgatagaaaaggaatccctggggcctcttcttttagaggctttg
gatggatttttctttgttgtgaactgtgaagggaggattgtatttgtgtcagaaaatgtg
accagctacttgggttacaatcaggaggaattaatgaataccagtgtctacagcatactg
catgtgggtgatcatgcagaatttgtgaagaatctgctaccaaaatcactagtgaatgga
gttccttggcctcaagaagcaacacgccaaaacagccatacctttaactgcaggatgcta
attcaccgtccagatgagcctggccccgagaaccaggaagcttgccagcggtatgaagtg
atgcagtgtttcactgtgtcacagccgaaatcgattcaggaggatggagaagatttccag
tcatgtttgatttgtattgcacggcgattacctcggcctccagctattacgggtgtagaa
tcctttatgaccaagcaagatactacaggtaaaatcatctctattgatactagttccctg
agagctgctggcagaactggctgggaagatttagtgagaaagtgcatttatgcttttttc
caacctcaaggcagagagccatcttacgccagacaactatttcaagaagtgatgactcgt
ggcactgcctccagcccatcctatagattcatattgaatgatgggacaatgcttagcgcc
cacaccaagtgtaaactttgctaccctcaaagtccagacatgcaacctttcatcatggga
attcatatcatcgacagggaacacagtggtctttctcctcaagatgacactaatcctgga
atgtcagtgccccgggtaaacccttccgtcaatcccagtatctctccagctcacggtgtg
gcccgttcgtctaccttgccaccatccaacagcaacatggtacccaccagagtaaaccgc
caacagagctcagaccttcatagcagcagtcatagcaattctagcaacagccaagggagt
tttggatgctcacctggaaatcagattgtagccagtgttgccttaaaccagggacaggcc
agttcccagagcactaatccccctttaaacctcaataattcccctatggaaggtacagga
atatcccttgcacagttcatgtctccaaggagacaagttagttctggattggcaacaagg
cccaggatgcctaacaattcatttcctcctaatattccaacattaagctcccccgttagc
atgacaagtactgcctgtaataatagtaaccgatcctattcaaacatcccagtaacacct
ttacagagtatgaatgaaggacccaataactctgttggcttctctgccagttctccagtc
ctcaggcagatgagctcacagaattcacctagcagattaaatatacaaccagcaaaagct
gaatccaaagataacaaagagattgcatccattttaaatgaaatgattcagtctgacaac
agctctaatgacagcaaacctctggattctgggcttctacataacaatgacagactctca
gatggagacaataaatactctcaaaccagtcacaaactagtgcagcttttgacaacgact
gcagagcagcagttacggcatgctgacatagacacaagttgcaaagaggtactgtcttgc
acaggcacttccacctctgcctctactaactcttcaagtggttcttgcccctcctctcat
agctcactgaccgagcggcacaaaatcctacaccgtctcttacaggagggtagcccctcg
gatatcacaactttgtcggtggagcctgataagaaggacagtgcatctacttctgtgtca
gtgactggacaggtccagggaaattccagtgtaaaactggaactggatgcttccaagaaa
aaagaatcaaaagaccatcagctcctacgctaccttttagataaagatgagaaagattta
agatctactccgaacctgagcctggatgatgtaaaggtgaaggtggaaaagaaagaacag
atggatccttgtaacacaaacccagcctccatgaccaaacctgctcctgaggaaattaaa
ctggagtcacagagccagtttacagctgaccttgaccagtttgatcagttacttccgacg
ctggagaaggcaccacagttgccaggcctatgtgagacagagaggatggatggcgcagtc
agcaatgtggccatcaaatcggagatcctgccatctgcacttcagtccacctctgccagg
cccacttccaggctgaacagattacctgaactggaattagaagcaattgataaccagttt
ggacaaccaggaactggtgatcagattccatgggcaaataatacagtgacagctgtaaat
cagaataagccagaagaccagtgtattagttcacaattagatgaacttctctgtccacca
acaacagtcgaaggaagaaatgatgagaaggcccttcttgaacagctggtatccttcctc
agtggaaaagatgaaactgagctagctgaactagacagagctttgggaattgacaagctt
gttcagggaggtggattagatgtattatcagagagatttccaccacagcaagcaacacca
ccattgatgatggaagaaagacccaacctttattcccagccttattcttctccttcgcct
actgccaatctctctagccctttccaaggcatggtcaggcaaaaaccttcactggggact
atgcctgttcaagtaacacctcctcgaggtgctttttcacctggcatgggcatgcagccc
aggcagacgctaaacagacctccagctgcacccaaccaacttagacttcaacttcaacaa
cgattgcaaggacaacagcagttgatacaccaaaatcggcaagctatcttgaaccaattt
gcagcaaacgctcctgttggcatcaatatgagatcaggcatgcagcagcaaattacacct
cagccacccctgaatgcccagatgttggcacagcgccagcgggagttgtatagtcaacag
caccgacagaggcagctaatacagcagcaaagagccatgctcatgaggcagcagagcttt
ggcaacagcctccctccctcatctggactgccagttcaaatggggaacccccgtcttcct
cagggtgctccgcagcagttcccctacccaccaaactatggtacaaatccaggaacacca
cctgcctctaccagccctttttcacaactggcagcaaatcccgaggcgcccttggccaac
cgcagcagcatggtgaacagaggcatgacaggaaacatgggtgggcagtttggcactgga
atcaatcctcagatgcagcagaacgtcttccagtacccaggatcaggaatggttccccaa
ggtgaggccaactttgctccatctctaagccctgggagctccatggtgccgatgccaatc
cctcctcctcagagctctctgctccagcagactccgcccacttctggctaccagtcacca
gacatgaaggcctggcagcaaggagcaatgggaaacaacaatgtattcagtcaagctata
cagaaccagcccacgcctgcacagccaggagtgtacaacaatatgagcatcaccgtgtcc
atggcaggtggaaacacaaatgttcagaacatgaacccaatgatgggccagatgcagatg
agctctttgcagatgccaggaatgagcactgtgtgccctgagcagataaatgatccagca
ctgagacacacaggcctctactgcaaccagctctcatccactgaccttctcaaaacagaa
gcagatggaacccagcaggtgcaacaggttcaggtgtttgctgacgtccagtgtacagtg
aatctggtaggcggggacccttacctgaaccagcctggtccactgggaactcaaaaaccc
acggcaggaccacagaccccccaggcccagcagaagagcctccttcagcagctactgact
gaataa

DBGET integrated database retrieval system