KEGG   Bos taurus (cow): 525346Help
Entry
525346            CDS       T01008                                 

Gene name
NCOA1
Definition
(RefSeq) nuclear receptor coactivator 1
  KO
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
bta  Bos taurus (cow)
Pathway
Estrogen signaling pathway
Thyroid hormone signaling pathway
Pathways in cancer
Breast cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    525346 (NCOA1)
   04919 Thyroid hormone signaling pathway
    525346 (NCOA1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    525346 (NCOA1)
   05224 Breast cancer
    525346 (NCOA1)
Enzymes [BR:bta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     525346 (NCOA1)
Chromosome [BR:bta03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    525346 (NCOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
11
AA seq 1441 aa AA seqDB search
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDEVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRQNSHTFNCRMLIHRPDEPGPENQEACQRYEVMQCFTVSQPKSIQEDGEDFQ
SCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDTNPGMSVPRVNPSVNPSISPAHGVARSSTLPPSNSNMVPTRVNR
QQSSDLHSSSHSNSSNSQGSFGCSPGNQIVASVALNQGQASSQSTNPPLNLNNSPMEGTG
ISLAQFMSPRRQVSSGLATRPRMPNNSFPPNIPTLSSPVSMTSTACNNSNRSYSNIPVTP
LQSMNEGPNNSVGFSASSPVLRQMSSQNSPSRLNIQPAKAESKDNKEIASILNEMIQSDN
SSNDSKPLDSGLLHNNDRLSDGDNKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKEVLSC
TGTSTSASTNSSSGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASTSVS
VTGQVQGNSSVKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKEQ
MDPCNTNPASMTKPAPEEIKLESQSQFTADLDQFDQLLPTLEKAPQLPGLCETERMDGAV
SNVAIKSEILPSALQSTSARPTSRLNRLPELELEAIDNQFGQPGTGDQIPWANNTVTAVN
QNKPEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKL
VQGGGLDVLSERFPPQQATPPLMMEERPNLYSQPYSSPSPTANLSSPFQGMVRQKPSLGT
MPVQVTPPRGAFSPGMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLIHQNRQAILNQF
AANAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQSF
GNSLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEAPLAN
RSSMVNRGMTGNMGGQFGTGINPQMQQNVFQYPGSGMVPQGEANFAPSLSPGSSMVPMPI
PPPQSSLLQQTPPTSGYQSPDMKAWQQGAMGNNNVFSQAIQNQPTPAQPGVYNNMSITVS
MAGGNTNVQNMNPMMGQMQMSSLQMPGMSTVCPEQINDPALRHTGLYCNQLSSTDLLKTE
ADGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTAGPQTPQAQQKSLLQQLLT
E
NT seq 4326 nt NT seq  +upstreamnt  +downstreamnt
atgagtggccttggggacagttcatctgaccctgctaacccagactcacataagagaaaa
gggtcaccatgtgacacactggcatcaagcactgaaaagaggcgcagggagcaagaaaat
aaatatttggaagagctagctgagttattgtctgccaacatcagtgacattgacagctta
agtgtaaaaccagacaaatgcaagatattgaagaagacagtcgatcagatacaactaatg
aagagaatggaacaagagaaatcaacaactgatgatgaagtacagaagtcagacatctca
tcaagcagtcaaggagtgatagaaaaggaatccctggggcctcttcttttagaggctttg
gatggatttttctttgttgtgaactgtgaagggaggattgtatttgtgtcagaaaatgtg
accagctacttgggttacaatcaggaggaattaatgaataccagtgtctacagcatactg
catgtgggtgatcatgcagaatttgtgaagaatctgctaccaaaatcactagtgaatgga
gttccttggcctcaagaagcaacacgccaaaacagccatacctttaactgcaggatgcta
attcaccgtccagatgagcctggccccgagaaccaggaagcttgccagcggtatgaagtg
atgcagtgtttcactgtgtcacagccgaaatcgattcaggaggatggagaagatttccag
tcatgtttgatttgtattgcacggcgattacctcggcctccagctattacgggtgtagaa
tcctttatgaccaagcaagatactacaggtaaaatcatctctattgatactagttccctg
agagctgctggcagaactggctgggaagatttagtgagaaagtgcatttatgcttttttc
caacctcaaggcagagagccatcttacgccagacaactatttcaagaagtgatgactcgt
ggcactgcctccagcccatcctatagattcatattgaatgatgggacaatgcttagcgcc
cacaccaagtgtaaactttgctaccctcaaagtccagacatgcaacctttcatcatggga
attcatatcatcgacagggaacacagtggtctttctcctcaagatgacactaatcctgga
atgtcagtgccccgggtaaacccttccgtcaatcccagtatctctccagctcacggtgtg
gcccgttcgtctaccttgccaccatccaacagcaacatggtacccaccagagtaaaccgc
caacagagctcagaccttcatagcagcagtcatagcaattctagcaacagccaagggagt
tttggatgctcacctggaaatcagattgtagccagtgttgccttaaaccagggacaggcc
agttcccagagcactaatccccctttaaacctcaataattcccctatggaaggtacagga
atatcccttgcacagttcatgtctccaaggagacaagttagttctggattggcaacaagg
cccaggatgcctaacaattcatttcctcctaatattccaacattaagctcccccgttagc
atgacaagtactgcctgtaataatagtaaccgatcctattcaaacatcccagtaacacct
ttacagagtatgaatgaaggacccaataactctgttggcttctctgccagttctccagtc
ctcaggcagatgagctcacagaattcacctagcagattaaatatacaaccagcaaaagct
gaatccaaagataacaaagagattgcatccattttaaatgaaatgattcagtctgacaac
agctctaatgacagcaaacctctggattctgggcttctacataacaatgacagactctca
gatggagacaataaatactctcaaaccagtcacaaactagtgcagcttttgacaacgact
gcagagcagcagttacggcatgctgacatagacacaagttgcaaagaggtactgtcttgc
acaggcacttccacctctgcctctactaactcttcaagtggttcttgcccctcctctcat
agctcactgaccgagcggcacaaaatcctacaccgtctcttacaggagggtagcccctcg
gatatcacaactttgtcggtggagcctgataagaaggacagtgcatctacttctgtgtca
gtgactggacaggtccagggaaattccagtgtaaaactggaactggatgcttccaagaaa
aaagaatcaaaagaccatcagctcctacgctaccttttagataaagatgagaaagattta
agatctactccgaacctgagcctggatgatgtaaaggtgaaggtggaaaagaaagaacag
atggatccttgtaacacaaacccagcctccatgaccaaacctgctcctgaggaaattaaa
ctggagtcacagagccagtttacagctgaccttgaccagtttgatcagttacttccgacg
ctggagaaggcaccacagttgccaggcctatgtgagacagagaggatggatggcgcagtc
agcaatgtggccatcaaatcggagatcctgccatctgcacttcagtccacctctgccagg
cccacttccaggctgaacagattacctgaactggaattagaagcaattgataaccagttt
ggacaaccaggaactggtgatcagattccatgggcaaataatacagtgacagctgtaaat
cagaataagccagaagaccagtgtattagttcacaattagatgaacttctctgtccacca
acaacagtcgaaggaagaaatgatgagaaggcccttcttgaacagctggtatccttcctc
agtggaaaagatgaaactgagctagctgaactagacagagctttgggaattgacaagctt
gttcagggaggtggattagatgtattatcagagagatttccaccacagcaagcaacacca
ccattgatgatggaagaaagacccaacctttattcccagccttattcttctccttcgcct
actgccaatctctctagccctttccaaggcatggtcaggcaaaaaccttcactggggact
atgcctgttcaagtaacacctcctcgaggtgctttttcacctggcatgggcatgcagccc
aggcagacgctaaacagacctccagctgcacccaaccaacttagacttcaacttcaacaa
cgattgcaaggacaacagcagttgatacaccaaaatcggcaagctatcttgaaccaattt
gcagcaaacgctcctgttggcatcaatatgagatcaggcatgcagcagcaaattacacct
cagccacccctgaatgcccagatgttggcacagcgccagcgggagttgtatagtcaacag
caccgacagaggcagctaatacagcagcaaagagccatgctcatgaggcagcagagcttt
ggcaacagcctccctccctcatctggactgccagttcaaatggggaacccccgtcttcct
cagggtgctccgcagcagttcccctacccaccaaactatggtacaaatccaggaacacca
cctgcctctaccagccctttttcacaactggcagcaaatcccgaggcgcccttggccaac
cgcagcagcatggtgaacagaggcatgacaggaaacatgggtgggcagtttggcactgga
atcaatcctcagatgcagcagaacgtcttccagtacccaggatcaggaatggttccccaa
ggtgaggccaactttgctccatctctaagccctgggagctccatggtgccgatgccaatc
cctcctcctcagagctctctgctccagcagactccgcccacttctggctaccagtcacca
gacatgaaggcctggcagcaaggagcaatgggaaacaacaatgtattcagtcaagctata
cagaaccagcccacgcctgcacagccaggagtgtacaacaatatgagcatcaccgtgtcc
atggcaggtggaaacacaaatgttcagaacatgaacccaatgatgggccagatgcagatg
agctctttgcagatgccaggaatgagcactgtgtgccctgagcagataaatgatccagca
ctgagacacacaggcctctactgcaaccagctctcatccactgaccttctcaaaacagaa
gcagatggaacccagcaggtgcaacaggttcaggtgtttgctgacgtccagtgtacagtg
aatctggtaggcggggacccttacctgaaccagcctggtccactgggaactcaaaaaccc
acggcaggaccacagaccccccaggcccagcagaagagcctccttcagcagctactgact
gaataa

DBGET integrated database retrieval system