KEGG   Bos taurus (cow): 538702Help
Entry
538702            CDS       T01008                                 

Definition
glycerol kinase 2-like (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bta  Bos taurus (cow)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    538702
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    538702
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     538702
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   538702
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
BGD-bta: 
Ensembl: 
UniProt: 
Position
2
AA seq 553 aa AA seqDB search
MAATKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPKEGWVEQDPKEI
LLSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKLTGEPLYNAVVWLDLRTQ
STVESLSKSIPVNNNFVKTKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEDRALFGTIDS
WLIWSLTGGARGGVHCTDVTNASRTMLFNIHSLEWDKELCEFFKVPMKILPNIRSSSEIY
GLMKAGSLEGVPISGCLGDQSAALVGQLCFQDGQAKNTYGTGCFLLCNTGHKCVFSEHGL
LTTVAYKLGRDKPVYYALEGSVAIAGAVVRWLRDNLGIIKTSEEIEKLANEVGTSYGCYF
VPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLS
HLQVDGGMTNNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLS
AVTMERFEPQINAKESEIRYSTWKKAVMKSMDWATTKSSQNGDTGIFSSLPLGFFVVSSM
VMLIGARYLSGVP
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggcagccacgaagaaagcagttttggggccgttggtgggagcagtggaccagggcacc
agctcgacgcgctttttggttttcaattcaaaaacagccgaactacttagtcatcatcaa
gtggaaataaaacaagagtttcctaaagaaggatgggtggaacaagaccctaaggaaatc
ctgctgtccgtgtatgagtgtatagagaaaacgtgtgagaaacttggacagctcaatatt
gatatttccaacataaaagctattggtgtcagtaaccagagggaaaccactgtagtctgg
gacaaattaactggagaacctctatacaatgctgtggtgtggctcgatctgagaacccag
tctaccgttgagagtcttagtaaaagcattccagtaaataacaactttgtcaagaccaag
acgggccttccactgagcacttacttcagcgcagtgaaacttcgttggcttcttgacaac
gtgagaaaagttcaaaaggcagttgaagaagatagagcgctttttgggaccattgattca
tggcttatttggagcttgacaggaggagcccgtggaggtgtccattgtacagatgtaaca
aatgcaagcaggacgatgcttttcaacattcactctttagaatgggataaagagctctgt
gagttttttaaagttccaatgaaaattctcccaaatatccggagttcttctgagatctat
ggcctaatgaaagctgggtctttggaaggtgtgcccatatcggggtgtctgggggaccag
tctgctgcattggtaggacaactgtgcttccaggatggacaagccaaaaacacgtatggg
acaggctgtttcttactatgcaatacaggccataagtgtgtattttctgaacatggcctt
ctgaccacagtggcttacaagctcggcagagacaaaccagtatattacgcactagaaggt
tcggtagctatagctggtgctgttgttcgctggctaagggacaatcttggaattataaag
acctcagaggaaattgaaaaacttgctaatgaagtaggtacctcttatggttgctatttc
gtcccagccttttcaggcctatatgccccttattgggagcccagtgccagagggatcatc
tgtgggctcactcagttcaccaataaatgccatattgcttttgctgcactagaggctgtt
tgtttccaaacccgagaaattctggacgccatgaaccgcgactgtggaattccactcagt
catttgcaggtggacggagggatgaccaacaacaaaattttgatgcaactgcaagccgac
attctgtatatcccggtagtgaagccctcgatgccggaaacgactgccttgggagctgcc
atggcagcaggggctgcagaaggggtcggcgtgtggagtctcgagcctgaggatttgtca
gctgtcacgatggagcggtttgaacctcagatcaacgccaaggagagcgaaattcgttat
tccacatggaagaaagctgtaatgaagtccatggattgggctaccactaagtcttcacaa
aatggtgacactggcatcttcagtagtctacccttgggcttttttgtagtgagtagcatg
gtaatgttaatcggagccaggtacctctcaggtgtgccataa

DBGET integrated database retrieval system