KEGG   Bacillus thuringiensis serovar finitimus YBT-020: YBT020_10250Help
Entry
YBT020_10250      CDS       T01839                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
btf  Bacillus thuringiensis serovar finitimus YBT-020
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:btf01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:btf00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:btf00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2026186..2027244
Genome map
AA seq 352 aa AA seqDB search
MYKGLLKQYASYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIQLYGKYEGANPTGSFKD
RGMVMAVAKAKEEGSEAIICASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVA
YGAEIISIEGNFDDALKAVRNIAAEEPITLVNSVNPYRIEGQKTAAFEICDQLQSAPDVL
AIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIDEPETIATAIRI
GNPASWSYAVEAAEQSHGEIDMVSDEEILHAYRLLAKSEGVFAEPGSNASLAGVMKHVQS
GKIKKGETVVAVLTGNGLKDPDIAISSNTLDIASVSNNIEQIKEHIKGVIMS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggattattaaaacagtatgcttcttatttaccggtcaatgaaaatacacct
gatgtgagcttaatggaagggaatacaccacttatcccgttattaaatatatcaaaacaa
ttaggaattcagttatacggtaagtatgaaggagcgaatccgacaggttcttttaaagat
cgaggtatggtaatggcagttgcaaaggcgaaagaagaagggtcagaggccattatttgt
gcatcaactggtaatacatcagcatcggccgcagcatatgcggcacgccttggaatgaaa
tgtattatcgtaatcccagaagggaaaattgcacatggaaaattagcgcaagcagtcgct
tacggagctgaaattatttcaatagaagggaattttgatgatgcacttaaggctgtaaga
aatattgctgcggaagagccaatcacattagttaactcggtaaatccttatcgaattgaa
gggcaaaaaacagcagcatttgaaatttgtgatcaattacaaagtgcaccagatgtgtta
gcaattcctgttggaaatgctggaaatattacagcatactggaaaggtttctgtgaatat
gaaaaagaaaaaggctataagaagccaagaattcatggatttgaagcggaaggagcagct
gctattgtaaaagggcatgtaattgacgagccagaaacaattgcaacagcgattcgcatc
ggtaacccagcaagttggtcatatgcagtagaggctgctgagcaatctcacggtgaaata
gatatggtatcagatgaagaaattttacatgcgtatagattattagcaaaatcggaaggg
gttttcgctgagccaggatcaaatgcttcattagctggcgtaatgaaacatgttcaatct
ggaaaaatcaaaaaaggagaaacagttgttgcagttttaactggaaacggcttgaaagat
cctgatatcgcaatctcttctaatacattagatattgcaagtgtttcaaataatatagaa
caaattaaagagcatattaaaggggtgattatgtcgtga

DBGET integrated database retrieval system