KEGG   Bacillus thuringiensis MC28: MC28_2487Help
Entry
MC28_2487         CDS       T02263                                 

Definition
hypothetical protein
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MC28_2487
Enzymes [BR:btm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     MC28_2487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2426700..2427857
Genome map
AA seq 385 aa AA seqDB search
MVKYISILGSTGSIGTSALDVVSAHPEHFKIVGLTANYNIDLLEKQIESFQPRIVSVATK
ELADTLRSRISTNTKITYGTDGLNEVSTHPDTNLVLSSVVGVSGLLPTIEALKAKKDIAI
ANKETLVAAGHIVTGLAKQNGCRLIPVDSEHSAIFQCLNGENNKEIEKLIVTASGGAFRD
KTREEMKTLQAKDALKHPNWLMGAKLTIDSATLMNKGFEVMEAKWLFDIPYEKIDVMIHK
ESIIHSLVEFIDGSVMAQLGAPDMRMPIQYAFHYPTRLPSSYEKLNLLEIGSLHFEKPNL
EKFPCLQYAFECGKIGGTTPAVLNAANEIANALFLKNEIAFFDIEKTIYNTVEAHHNVKD
PSLDAILEADQWARQYANQLLIKKS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaatatatatccattttaggttcaacaggatccattggcacatctgcattagat
gtcgtttccgctcatcctgaacattttaaaatcgtcggtttaaccgcaaattataatatc
gatcttctcgaaaaacaaattgaatcgtttcagcctcgtattgtaagcgtagcgacaaaa
gaattagcggacacattacgttctcgtatttcaacaaatacaaaaataacatatggaact
gatggtttaaatgaagtatctacccatcctgatacaaatcttgtattaagttcagttgtc
ggtgtttcaggtttactcccaacaattgaagcattaaaggcgaagaaagatatcgccatc
gctaacaaagaaactttagttgccgctggtcatatcgtaactggactagcgaaacaaaac
ggatgccgcctaattccagtcgatagtgagcattcagctattttccaatgtttaaacgga
gaaaataataaagagattgagaagttaattgtcacagcttctggcggcgcttttcgtgat
aaaacacgtgaagaaatgaaaacattacaagcgaaggatgctttaaaacatccaaactgg
ttaatgggagcaaaactaacgatagattctgccacgttaatgaataaagggtttgaagtg
atggaagctaaatggctgttcgatattccttatgaaaaaattgacgttatgattcataaa
gaaagtatcattcactctttagtggaatttattgatggatcagtcatggcacaactcggt
gctcctgatatgagaatgccgattcaatatgcgtttcactaccctactcgactaccttca
tcctatgaaaaattaaatttattagaaattggtagtttgcattttgaaaaaccaaattta
gagaagttcccctgtctacaatacgcatttgaatgtggcaaaattggcggtacaactcca
gccgtattaaatgcagcgaacgaaattgcaaatgcactatttcttaaaaatgaaattgca
tttttcgatatcgaaaaaacaatttacaatacagttgaagctcatcataacgtaaaagat
ccttcactcgatgctatattagaagctgatcaatgggcacgccaatacgcaaatcaatta
ttaataaaaaagagctaa

DBGET integrated database retrieval system