KEGG   Bacillus thuringiensis MC28: MC28_4760Help
Entry
MC28_4760         CDS       T02263                                 

Definition
hypothetical protein
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
btm  Bacillus thuringiensis MC28
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:btm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MC28_4760
Enzymes [BR:btm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     MC28_4760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4644485..4645342
Genome map
AA seq 285 aa AA seqDB search
MKAPAKINLSLDVLGKRQDGYHEVKMIMTTIDLADRLELMELAEDRIEILSHNRYVPDDQ
RNLAYQAAKLLKEKFNVKKGVSITIEKTIPVAAGLAGGSSDAAATLRGLNKLWNLGLTIE
ELAELGSEIGSDVSFCVYGGTAIATGRGERIEHIKTPPSCWVILAKPHIGVSTADVYGNL
KLNRVTHPNVDKMVDVINAGDYKGICDTVGNVLEDVTFKMHPEVARIKAQMKRFGADAVL
MSGSGPTVFGLVHHDSRMHRIYNGLKGFCEQVYAVRLLGERETLE
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcaccagcaaagattaatctgtcgttagatgtactgggaaaaagacaagacgga
tatcatgaagtgaaaatgattatgacaacaattgatttagcggatcgtttagaactaatg
gaattagcagaagaccgtattgaaattttatcccataatcggtatgtcccagacgaccaa
cgaaatttagcttatcaagcagcgaaattattaaaagagaagtttaatgtgaaaaaaggt
gtatctattactattgaaaaaacgattccagtagcagctggattagcaggtggaagtagt
gatgcagcagcgacattacgtggtcttaataaattatggaatttagggcttacaattgaa
gaattagcagagcttggctcagaaattggatcagatgtatcgttctgtgtatatggaggg
acagcaattgccactggaagaggagagcgaattgagcatataaaaacgccaccttcttgt
tgggttattttagcgaagccacatattggtgtatctactgctgacgtgtatggaaattta
aaactaaatcgagttacacatccaaatgtagataaaatggttgatgtcatcaatgctgga
gattacaaagggatttgtgatactgttggtaacgtcttagaagatgtaacatttaagatg
catcccgaagttgctcgtattaaagcacagatgaaacgatttggagcagatgctgtacta
atgagtggaagtggtccaactgtattcggacttgtacaccatgattcgcgaatgcatcgc
atttataacggattaaaaggattttgtgaacaagtatatgcggtacgtttattaggagag
cgagaaacgcttgaataa

DBGET integrated database retrieval system