KEGG   Buchnera aphidicola APS (Acyrthosiphon pisum): BU305Help
Entry
BU305             CDS       T00036                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
buc  Buchnera aphidicola APS (Acyrthosiphon pisum)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:buc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BU305 (pfkA)
   01230 Biosynthesis of amino acids
    BU305 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BU305 (pfkA)
   00030 Pentose phosphate pathway
    BU305 (pfkA)
   00051 Fructose and mannose metabolism
    BU305 (pfkA)
   00052 Galactose metabolism
    BU305 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BU305 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BU305 (pfkA)
Enzymes [BR:buc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BU305 (pfkA)
Protein phosphatases and associated proteins [BR:buc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BU305 (pfkA)
Messenger RNA biogenesis [BR:buc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BU305 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
338127..339089
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRTALSERLEVFGIYDGYLGLYENRMVQLDRYSVSD
MINRGGTFLGSARFASFYQDKIRSIAVQNIKKRKIDALVVIGGDGSYIGAQKLTEMGIPC
ISIPGTIDNDVSGTDYTIGYFTALQTVVEAIDRLRDTSSSHQRISIVEVMGRHCGDLTLA
AAIAGGCEFIVLPEIDYKKEDLVIEIQAGIAKGKKHAIVAITEYICDVEELAQYIEKKTN
RETRATILGHIQRGGAPVVYDRILASRMGAYSVELLIKGYQGKCVGIQNEKMVFNDIKNA
LKNMKRTFKKDWLITAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaattggagttttaactagtggtggcgatgctccagggatgaatgccgca
attagaggggttgttagaacagcacttagtgaaagattagaagtatttggaatttatgat
ggatatttaggtctatatgaaaaccgtatggtgcaacttgatagatatagtgtatctgac
atgattaacagaggtgggacatttttagggtcagctagatttgctagtttttatcaagac
aaaatacgctcaattgcagtgcaaaatataaaaaaaagaaaaatagatgctcttgttgtc
attggaggtgatggttcttatataggagctcaaaaattaacagaaatgggtattccatgt
attagcattccaggtactatcgataatgatgtttcaggtactgattatacaataggttat
tttacagctttacaaacagtggttgaagctattgatcgattgcgcgacacttcttcttct
caccaacgtatttctattgtagaggtgatgggtagacattgtggagatttaacattagct
gcagctattgctggtggatgcgaatttattgttttaccagaaattgactataaaaaagaa
gatctagttatcgagattcaagctggcattgctaagggcaaaaaacatgctattgttgcc
ataactgaatacatttgtgatgtagaagaattagcacaatatattgaaaaaaaaactaat
cgagaaactagagcgacaattcttggacatatccaaagagggggtgcacctgtagtatat
gatcgtatattagcatcaagaatgggtgcatattcagttgaattattaataaaaggttat
cagggaaaatgtgttggaatacaaaatgaaaaaatggtttttaacgatataaaaaacgca
ctaaaaaatatgaaacgtacttttaaaaaagattggttgattactgctaaaaagttatac
taa

DBGET integrated database retrieval system