KEGG   Candidatus Blochmannia vafer (Camponotus vafer): BVAF_517Help
Entry
BVAF_517          CDS       T01398                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bva  Candidatus Blochmannia vafer (Camponotus vafer)
Pathway
bva00300  Lysine biosynthesis
bva01100  Metabolic pathways
bva01120  Microbial metabolism in diverse environments
bva01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bva00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BVAF_517 (dapE)
Enzymes [BR:bva01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BVAF_517 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 DUF2689
Motif
Other DBs
NCBI-ProteinID: ADV33900
UniProt: E8Q776
Position
587942..589114
Genome map
AA seq 390 aa AA seqDB search
MTISLIELTKKLINQPSITPKDHNCQNIIACYLKSLKFNIELMNFYDTHNIWAYRNGQHK
QKQQHTTTLLFLGHTDVVSPGNTQNWKYPPFSGLINNGVLYGRGASDMKGALAAMLIAAQ
HFIQRHPNHKKKIAFLFTSDEEGSGKNGTIKAVQQLIERNEHIEYCIVGEPSSQNKLGDV
IKNGRRGSCTGKLIIQGSSGHVAYPQFLINPIHLTIPMLFDLMNIKWDQKNSIIFPKTSI
QITNINTVPANCTTHNITPDQLILNFNLRFSDQSSIKSIQNNINKILSMHSLNYHIYWDP
CISEPYFSNPGKLTNVVTNIITKHYHYNIIPRLETTGGISDGRFIAKTGSEVLELGALNH
TIHKFNEHIKLTDLKLLSYFYFKIMEKMLL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgactatttcactaatagaattaacaaaaaaattaatcaatcaaccttcaattactcca
aaggatcataattgtcaaaatattattgcttgttatttaaagtcattgaaatttaatata
gaacttatgaatttttatgatacacacaacatatgggcttatcgaaatggacaacataaa
caaaaacaacaacatacaacaacattattatttttaggacacacagatgtagtatctcct
ggcaatactcaaaattggaaatatccacctttttcaggattaataaacaatggagttcta
tatggacgaggtgcatcagatatgaaaggggctttagcagctatgttaatagccgcccaa
cattttattcaaagacatcctaatcataaaaaaaagatagcattcctcttcacttctgat
gaagaaggttctggaaaaaacggcaccataaaagcagttcaacaattaatagagcgcaat
gaacatatagagtattgtatagtaggcgaaccatccagtcaaaataaattaggagatgta
attaaaaatggacgacgaggttcttgtacaggtaaattaattatacaaggttcatctggg
catgttgcttatccacaatttctaataaatccaatacatttaacaatacccatgttattt
gatttaatgaatataaaatgggatcaaaaaaacagtataatatttcctaaaacatctatt
caaataaccaatatcaataccgtacctgctaattgtacaacacacaatattacaccagat
caattgatattaaattttaatttacgatttagtgatcaatcttctataaaaagtattcaa
aataatattaacaaaattttatccatgcattctttaaattatcatatatattgggaccca
tgtatctcagaaccctattttagtaatcctgggaaattaaccaacgttgttacaaatatt
attacaaaacattatcattacaatatcattccacgattagaaactacaggaggtatttct
gatggacgatttatcgctaaaacaggatcagaagtcttagaattaggagctcttaatcat
acaattcataaatttaacgaacatataaaattaacagatttaaaattattaagttacttt
tattttaaaattatggaaaaaatgctattgtaa

DBGET integrated database retrieval system