KEGG   Burkholderia xenovorans LB400: Bxe_B0981Help
Entry
Bxe_B0981         CDS       T00340                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bxe  Burkholderia xenovorans LB400
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bxe_B0981
   01230 Biosynthesis of amino acids
    Bxe_B0981
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bxe_B0981
  Energy metabolism
   00680 Methane metabolism
    Bxe_B0981
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bxe_B0981
Enzymes [BR:bxe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Bxe_B0981
Exosome [BR:bxe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Bxe_B0981
  Exosomal proteins of melanoma cells
   Bxe_B0981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(2275673..2276395)
Genome map
AA seq 240 aa AA seqDB search
MTLQTGTLVVLRHGQSIWNRANRFTGWSDVGLSVQGVADAQRVGERLREAGFRFDLAVTS
ALLRATDTLAHVLRTLEQPPPRTVRSWRLNDRHYGMLTGMEKDEAALAYGAERVRQWRRG
FDLAPPALDADLHAALVRALHDDAMPHADALPRTESLRDTLRRVLPLWDECVAPALTRGQ
SVLMVGHGNSLRALFKQLDNIGDDAIASVEVAHAEPLVMKFDATLSVISRTPLAALAASR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgactcttcaaacgggcacgctggtcgtgctgcgtcatggccagtcgatatggaatcgc
gccaaccgttttaccggctggagcgacgtcggcctgtccgtgcagggcgtggccgatgcg
cagcgtgtcggcgaacggttgcgcgaggcgggctttcgcttcgacctggcggtgacctcg
gcgctgctgcgcgccaccgatacactcgcgcacgtgctgcgaacccttgagcagccgccg
cccagaaccgtgcgctcgtggcggctgaatgaccgccactacggcatgctgaccggcatg
gaaaaagacgaggccgcgctcgcctatggcgcggagcgggtgcggcaatggcggcgcggt
ttcgacctggcgccgccggcgctcgatgcagacctgcacgcggcactcgtgcgtgcattg
cacgacgacgcgatgccccacgccgacgcgctgccccgcaccgaaagcctgcgcgacacg
ttgcggcgcgtgctgccgctgtgggacgaatgcgtggcacccgcgctgacgcgtgggcag
tcggtgctgatggtggggcatggcaactcgttgcgcgcgcttttcaagcaactcgacaac
atcggcgacgacgcgatcgcttcggtcgaggtcgcgcatgcggaaccgttggtcatgaag
ttcgacgcaacgctctcggtgatttcgcgcacaccgctcgccgcgctggcagctagccgc
tga

DBGET integrated database retrieval system