KEGG   Paraburkholderia xenovorans LB400: Bxe_B0981Help
Entry
Bxe_B0981         CDS       T00340                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00010  Glycolysis / Gluconeogenesis
bxe00260  Glycine, serine and threonine metabolism
bxe00680  Methane metabolism
bxe01100  Metabolic pathways
bxe01110  Biosynthesis of secondary metabolites
bxe01120  Microbial metabolism in diverse environments
bxe01130  Biosynthesis of antibiotics
bxe01200  Carbon metabolism
bxe01230  Biosynthesis of amino acids
Module
bxe_M00002  Glycolysis, core module involving three-carbon compounds
bxe_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bxe_B0981
  Energy metabolism
   00680 Methane metabolism
    Bxe_B0981
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bxe_B0981
Enzymes [BR:bxe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Bxe_B0981
Membrane trafficking [BR:bxe04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Bxe_B0981
Exosome [BR:bxe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Bxe_B0981
  Exosomal proteins of melanoma cells
   Bxe_B0981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABE34973
JGI: BxeB0981
UniProt: Q13LR6
Position
2:complement(2275673..2276395)
Genome map
AA seq 240 aa AA seqDB search
MTLQTGTLVVLRHGQSIWNRANRFTGWSDVGLSVQGVADAQRVGERLREAGFRFDLAVTS
ALLRATDTLAHVLRTLEQPPPRTVRSWRLNDRHYGMLTGMEKDEAALAYGAERVRQWRRG
FDLAPPALDADLHAALVRALHDDAMPHADALPRTESLRDTLRRVLPLWDECVAPALTRGQ
SVLMVGHGNSLRALFKQLDNIGDDAIASVEVAHAEPLVMKFDATLSVISRTPLAALAASR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgactcttcaaacgggcacgctggtcgtgctgcgtcatggccagtcgatatggaatcgc
gccaaccgttttaccggctggagcgacgtcggcctgtccgtgcagggcgtggccgatgcg
cagcgtgtcggcgaacggttgcgcgaggcgggctttcgcttcgacctggcggtgacctcg
gcgctgctgcgcgccaccgatacactcgcgcacgtgctgcgaacccttgagcagccgccg
cccagaaccgtgcgctcgtggcggctgaatgaccgccactacggcatgctgaccggcatg
gaaaaagacgaggccgcgctcgcctatggcgcggagcgggtgcggcaatggcggcgcggt
ttcgacctggcgccgccggcgctcgatgcagacctgcacgcggcactcgtgcgtgcattg
cacgacgacgcgatgccccacgccgacgcgctgccccgcaccgaaagcctgcgcgacacg
ttgcggcgcgtgctgccgctgtgggacgaatgcgtggcacccgcgctgacgcgtgggcag
tcggtgctgatggtggggcatggcaactcgttgcgcgcgcttttcaagcaactcgacaac
atcggcgacgacgcgatcgcttcggtcgaggtcgcgcatgcggaaccgttggtcatgaag
ttcgacgcaacgctctcggtgatttcgcgcacaccgctcgccgcgctggcagctagccgc
tga

DBGET integrated database retrieval system