KEGG   Bacillus amyloliquefaciens XH7: BAXH7_01604Help
Entry
BAXH7_01604       CDS       T01836                                 

Gene name
yngB
Definition
(GenBank) putative UTP-sugar-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
bxh00040  Pentose and glucuronate interconversions
bxh00052  Galactose metabolism
bxh00500  Starch and sucrose metabolism
bxh00520  Amino sugar and nucleotide sugar metabolism
bxh01100  Metabolic pathways
bxh01130  Biosynthesis of antibiotics
Module
bxh_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bxh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BAXH7_01604 (yngB)
   00052 Galactose metabolism
    BAXH7_01604 (yngB)
   00500 Starch and sucrose metabolism
    BAXH7_01604 (yngB)
   00520 Amino sugar and nucleotide sugar metabolism
    BAXH7_01604 (yngB)
Enzymes [BR:bxh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BAXH7_01604 (yngB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD
Motif
Other DBs
NCBI-ProteinID: AEK88742
Position
complement(1482829..1483722)
Genome map
AA seq 297 aa AA seqDB search
MRKKVRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPAIQYIVEEAAESGIEDILIITGR
NKRSIEDHFDRLAELEFNLQEKGKTEMLKEMQQIADLANIHYIRQKEPLGLGHAVLCAEH
FIGDEPFAVLLGDDIMVSDTPALSQLIDVYNQHGTETIGVQPVEPADVSKYGIIQTGRQS
GHVYQVEDLIEKPAAEKAPSRIAVMGRYILTPAIFQALKTIGRGAGSEIQLTDALRKVCR
TRSIYARELEGSRFDIGDKLGCFKAGTEIGLLRKEMRPKLLAYLEEVLKRESEEMTH
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaagtgagaaaagcggtcatccccgcagcgggtttaggcacgagatttctg
ccggcgacaaaggcgcagccgaaagaaatgctgccgattgtcgacaaaccggcaatccaa
tatattgtagaagaggccgcagaatcaggaattgaagatatactgattattacggggaga
aacaaacgctcgattgaagatcattttgaccggttggcggaattggaattcaatctgcag
gaaaaaggcaagacggagatgcttaaggaaatgcagcagattgccgatttggccaatatt
cattacatccgccagaaagagccgctcggcttaggacatgcggtattgtgtgcggagcat
tttatcggagatgagccttttgccgttctcttaggagatgatattatggtatctgacacc
cccgcgctttcgcagctcatagacgtctataaccagcacggcacagaaacaatcggcgta
cagcccgtcgagcctgctgatgtcagcaaatatggtattatacagacggggcggcaaagc
ggtcatgtgtatcaggttgaagacctgattgagaagccggctgctgaaaaggcgccctca
cgtattgccgtgatgggccgatacatattaacccctgccattttccaggcgctcaaaacg
atcggacgaggcgcgggcagcgaaatccaattaactgatgcgctgcgcaaagtgtgccgc
acccggagcatttacgcgcgggaacttgaaggaagccggttcgatataggcgataagctc
gggtgttttaaagccgggacggagatcgggcttctgcggaaagaaatgagaccgaaactt
ttagcttatttagaagaggtgttaaaaagagaatctgaagaaatgacgcattaa

DBGET integrated database retrieval system