KEGG   Burkholderia sp. YI23: BYI23_A006810Help
Entry
BYI23_A006810     CDS       T01711                                 

Definition
2,3-dimethylmalate lyase
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
byi  Burkholderia sp. YI23
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BYI23_A006810
Enzymes [BR:byi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BYI23_A006810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:768788..770485
Genome map
AA seq 565 aa AA seqDB search
MNALTQIPVGYSRTMRLREMLQSNRLEFLMEAHNGISARIAKEAGFKAIWGSGLSISAQF
GVRDNNEASWTQVVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIE
DKQFPKTNSFINGEAQPLADIDEFCGKIKAGKDSQSDPNFSIVARVEALIAGWGMEEALK
RAEAYRQAGADAILIHSKLSKPDEILTFAREWAGRGPLVIVPTKYYSTPTDAFRQAGISC
VIWANHLIRGAVSAMQAIAKEIHDSETLVNVEDRIAAVNEIFRLQDADEYSAAENIYLTA
ANEKRSAIVLAASRGAGLEALTEARPKVMLPVAGKPLLRHLVEAFKKESINDITVVGGYR
ADAIESGGIRLVVNERHETTGELASLACAAKHMNGDTVISYGDLLFRSYILRDLTESDSD
FCVVVDSSQAPQAGDTVTDFAYCSTGDDRALFGQKVWLESVVGAGQSLIENRAPQGRWMG
LIKVRGGARERLLATLGTLQQRADFDQLDMAALLNALIAAGQKIEVQYVHGHWRGVNDLD
DFRRAGDFAHGQTPIGSEGAENARD
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcactcacacaaatcccggtcggctactcgcgcacgatgcgcctgcgcgaaatg
ctgcaaagcaatcgcctcgaattcctgatggaagcgcacaacggcatctccgcgcgcatc
gcgaaggaagcgggcttcaaggcgatctggggctcgggcctgtcgatttccgcgcaattc
ggcgtgcgcgacaacaacgaggcaagctggacgcaagtcgtcgacaacctcgaattcatg
gcggacgcgagcgatctgccgattctcctcgacggcgacaccggctacggcaacttcaac
aacgtgcgccggctcgtgaagaagctggaacagcgcggcatcgcgggcgtgtgcatcgaa
gacaagcagtttccgaagaccaacagcttcatcaacggcgaggcgcagccgctcgcggac
atcgacgaattctgcggcaagatcaaggccggcaaggattcgcagagcgatccgaatttc
tcgatcgtcgcgcgcgtcgaggcgctgatcgcgggctggggcatggaagaagcgttgaag
cgcgccgaggcgtaccgtcaggcgggcgcggacgcgatcctgattcattcgaagctctcg
aagccggacgaaatcctcacgttcgcgcgtgaatgggccgggcgcggcccgctcgtcatc
gtgccgacgaagtactacagcacgccgaccgacgcgttccgtcaggcgggcatcagttgc
gtgatctgggcgaaccatctgattcgcggcgcggtctcggcgatgcaggcgatcgcgaag
gaaatccacgacagcgagacgctcgtcaacgtggaagaccgcatcgcggcggtcaacgag
attttccgtttgcaggacgcggacgaatactcggccgccgagaacatctatctgacggcg
gcgaatgaaaagcgcagcgcgatcgtgctggccgcgagccgcggcgcgggcctcgaagcg
ctgaccgaagcgcgtccgaaggtcatgctgccggtcgcgggcaagccgcttttgcgccat
ctcgtcgaggcgttcaagaaggaaagcatcaacgacatcacggtcgtcggcggatatcgc
gcggacgcgatcgagtcgggcggcatccgtctcgtcgtcaacgaacggcatgaaacgacg
ggcgagctcgcctcgctcgcctgcgccgcgaagcacatgaacggcgacaccgtgatttcc
tacggcgatctgctgttccgcagctacatcctgcgcgatctgacggaatcggacagcgat
ttctgcgtggtcgtggattcgtcgcaggcgccgcaggcgggcgacaccgtcaccgacttc
gcgtactgctcgaccggcgacgaccgcgcgctcttcggccagaaagtgtggctcgaaagc
gtggtcggcgcggggcagtcgctgatcgaaaatcgcgcgccgcagggccgctggatgggt
ctcatcaaggtgcgcggcggcgcgcgcgagcgtttgctcgcgacgctcggcacgctgcag
cagcgcgccgacttcgaccagctcgacatggccgcgctcctgaacgcgctgatcgccgcc
ggccagaagatcgaagtgcagtacgtgcacggccactggcgcggcgtgaacgatctcgac
gatttccgtcgcgcgggcgatttcgcgcacggccagacgccgatcggctccgaaggcgcg
gagaacgcgcgtgattga

DBGET integrated database retrieval system