KEGG   Burkholderia sp. YI23: BYI23_B013580Help
Entry
BYI23_B013580     CDS       T01711                                 

Definition
(GenBank) D-beta-3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00072  Synthesis and degradation of ketone bodies
byi00650  Butanoate metabolism
byi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BYI23_B013580
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BYI23_B013580
Enzymes [BR:byi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BYI23_B013580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase
Motif
Other DBs
NCBI-ProteinID: AET91965
UniProt: G8MDA3
Position
2:complement(1573597..1574382)
Genome map
AA seq 261 aa AA seqDB search
MTSNKSLAGKTALVTGSTSGIGLGIATALAQNGANLVLNGFGDIDGALKQIEATGVKAVH
HPADMTKPQEIEAMIAFANEQFGGVDILVNNAGIQHVATIEEFPVDRWDAIIAINLSSAF
HTMRVALPQMRARNWGRVINIASVHGLVGSAGKSAYVAAKHGILGLTKVAALENARSGVT
INAICPGFVLTPLVQKQIDDLAARDALSPDAARTKLLGDKQPSAQFVTAQQIGDMAVFLC
SDAASEMRGSALQIDGGWSAQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaaacaaatccctcgcaggcaagacggcgctagtcaccggctccacaagcgga
atcggcctcggcatcgccaccgcgctggcgcaaaacggcgcgaacctcgtcctcaacggc
ttcggcgacatcgacggcgccctgaagcaaatcgaggcaaccggcgtgaaagccgtgcat
caccccgccgacatgacgaagccgcaagaaatcgaagcgatgatcgccttcgcgaacgag
cagttcggcggcgtcgatatcctcgtgaacaacgccggcatccagcatgtcgccaccatc
gaggaattccccgtcgatcgctgggacgcgatcatcgcgatcaatctgagctctgccttc
cacacgatgcgcgtcgcgctgccgcaaatgcgcgcgcgcaactggggccgcgtgatcaat
atcgcgtcggtgcacgggctcgtcggctccgcgggcaagtcggcttatgtcgctgcgaag
cacggcattctcggcctcaccaaagtcgccgcgctcgaaaacgcgcgcagcggcgtcacc
atcaacgcaatctgcccgggcttcgtgctcacgccgctcgtgcagaagcaaatcgacgat
ctcgccgcacgcgacgcgctctcgcccgacgcggcgcgcacgaagctgctcggcgacaag
cagccctccgcgcaattcgtgacggcgcagcagatcggcgacatggccgtgttcctgtgc
tccgacgccgcaagcgaaatgcgcggctcggcgctgcagatcgacggcggctggagcgcg
caataa

DBGET integrated database retrieval system