KEGG   Burkholderia sp. YI23: BYI23_B013580Help
Entry
BYI23_B013580     CDS       T01711                                 

Definition
D-beta-3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
byi  Burkholderia sp. YI23
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BYI23_B013580
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BYI23_B013580
Enzymes [BR:byi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BYI23_B013580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1573597..1574382)
Genome map
AA seq 261 aa AA seqDB search
MTSNKSLAGKTALVTGSTSGIGLGIATALAQNGANLVLNGFGDIDGALKQIEATGVKAVH
HPADMTKPQEIEAMIAFANEQFGGVDILVNNAGIQHVATIEEFPVDRWDAIIAINLSSAF
HTMRVALPQMRARNWGRVINIASVHGLVGSAGKSAYVAAKHGILGLTKVAALENARSGVT
INAICPGFVLTPLVQKQIDDLAARDALSPDAARTKLLGDKQPSAQFVTAQQIGDMAVFLC
SDAASEMRGSALQIDGGWSAQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaaacaaatccctcgcaggcaagacggcgctagtcaccggctccacaagcgga
atcggcctcggcatcgccaccgcgctggcgcaaaacggcgcgaacctcgtcctcaacggc
ttcggcgacatcgacggcgccctgaagcaaatcgaggcaaccggcgtgaaagccgtgcat
caccccgccgacatgacgaagccgcaagaaatcgaagcgatgatcgccttcgcgaacgag
cagttcggcggcgtcgatatcctcgtgaacaacgccggcatccagcatgtcgccaccatc
gaggaattccccgtcgatcgctgggacgcgatcatcgcgatcaatctgagctctgccttc
cacacgatgcgcgtcgcgctgccgcaaatgcgcgcgcgcaactggggccgcgtgatcaat
atcgcgtcggtgcacgggctcgtcggctccgcgggcaagtcggcttatgtcgctgcgaag
cacggcattctcggcctcaccaaagtcgccgcgctcgaaaacgcgcgcagcggcgtcacc
atcaacgcaatctgcccgggcttcgtgctcacgccgctcgtgcagaagcaaatcgacgat
ctcgccgcacgcgacgcgctctcgcccgacgcggcgcgcacgaagctgctcggcgacaag
cagccctccgcgcaattcgtgacggcgcagcagatcggcgacatggccgtgttcctgtgc
tccgacgccgcaagcgaaatgcgcggctcggcgctgcagatcgacggcggctggagcgcg
caataa

DBGET integrated database retrieval system