KEGG   Chloroflexus aggregans: Cagg_2097Help
Entry
Cagg_2097         CDS       T00824                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cag  Chloroflexus aggregans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cagg_2097
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cagg_2097
  Amino acid metabolism
   00310 Lysine degradation
    Cagg_2097
Enzymes [BR:cag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Cagg_2097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2571512..2572846
Genome map
AA seq 444 aa AA seqDB search
MIDIKMPQLGESVTEGTVGRWLKRPGEPVAKYEPLLEVVTDKVDTEVPAPEAGVLHEILV
PEGETVRVGTVIARLAPAGAAVSTPTPVAATSAVAVSTTSASATTTTTVAPPASDGRNTY
LSPVVARLLAEHNLDPAQIRGTGQGGRITKQDVMRFLAERERQAVNAPAPTPAPVAAPTP
APTPAPVAAPTPMPTPAPVAAPSPTPAPTPVEIPADAELVPLTPMRRSIAEHMARSVRTS
PHVTTVMEADLSRVLAHRAAHQEAFNRQGVRLTLTPYFIIAAIAGLQAVPVFNGSFTEQG
IILHRRINVGIAVALNEGLLVPVIPDADEKNLLGLARAVNDLAERARTRRLRPEETQGGT
FTITNHGVTGSLFATPIINQPQAGILGIGAVVKRPVVISQNGLDAIAIRPLCYLSFTFDH
RIADGATADRFLATVKQRLEQWES
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacatcaaaatgccccaactcggcgagagcgttaccgaaggtactgttggccgc
tggctgaaacggcccggcgaaccggtcgcgaaatacgaaccgttgttggaagtagttacc
gataaggtcgatacggaggtaccggcgcctgaagctggtgttctccacgagattttggtt
cccgaaggtgagacggtacgggtgggaacggtgatcgcacggctcgccccggcaggagct
gcggtgagcacgccaacaccggtggctgcgacgagtgctgtagcagtctccacgaccagt
gcctcggcaaccaccacgacaacggtggctccaccggccagtgatgggcgtaatacctat
ctctcgccggtcgtagcgcggttgctcgccgaacacaaccttgatccggcgcagattcgc
ggtactggacaaggcgggcgtattaccaaacaagatgttatgcgcttcctcgccgaacgt
gaacgccaggcggtgaacgcgccggctcccacacccgcgccggtcgctgctcctaccccg
gctcccacacccgcgccggtcgctgctcctaccccgatgcctacacccgcgccggtcgct
gctccttcgccgacgcccgcgcccacaccggttgagattcctgctgacgctgaattggtg
ccattgacgccaatgcggcgcagcattgccgagcatatggctcgctcggtacgcacctcg
ccgcacgtcacaactgtgatggaggcagatttgagccgcgtgctcgcccatcgagccgct
catcaagaagcctttaatcggcaaggtgtgcgtctcacgcttaccccatatttcatcatt
gccgctattgccggactacaagccgtaccggtattcaacggcagcttcaccgagcaaggt
atcatcctacatcgccgtattaatgtggggattgcagttgcgctcaacgaaggtctattg
gtaccggtcattcctgatgctgacgagaagaatctgctcggcctggcccgtgccgtcaac
gatctcgccgaacgggcacgtaccaggcgtttgcgcccagaagaaacacaaggtggtacg
ttcaccatcacgaaccacggggtgaccggtagcctgtttgcaacgccgatcatcaatcag
ccgcaggccggtattctcggtatcggtgcagtggtcaaacgaccggtcgttatttcccaa
aatgggcttgatgccatcgccattcgtccgctctgctatctctcgtttaccttcgatcac
cggattgccgatggcgccactgccgaccgattcctcgctaccgttaaacaacggctcgaa
cagtgggagagttaa

DBGET integrated database retrieval system