KEGG   Chloroflexus aggregans: Cagg_2097Help
Entry
Cagg_2097         CDS       T00824                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cag  Chloroflexus aggregans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cagg_2097
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cagg_2097
  Amino acid metabolism
   00310 Lysine degradation
    Cagg_2097
Enzymes [BR:cag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Cagg_2097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2571512..2572846
Genome map
AA seq 444 aa AA seqDB search
MIDIKMPQLGESVTEGTVGRWLKRPGEPVAKYEPLLEVVTDKVDTEVPAPEAGVLHEILV
PEGETVRVGTVIARLAPAGAAVSTPTPVAATSAVAVSTTSASATTTTTVAPPASDGRNTY
LSPVVARLLAEHNLDPAQIRGTGQGGRITKQDVMRFLAERERQAVNAPAPTPAPVAAPTP
APTPAPVAAPTPMPTPAPVAAPSPTPAPTPVEIPADAELVPLTPMRRSIAEHMARSVRTS
PHVTTVMEADLSRVLAHRAAHQEAFNRQGVRLTLTPYFIIAAIAGLQAVPVFNGSFTEQG
IILHRRINVGIAVALNEGLLVPVIPDADEKNLLGLARAVNDLAERARTRRLRPEETQGGT
FTITNHGVTGSLFATPIINQPQAGILGIGAVVKRPVVISQNGLDAIAIRPLCYLSFTFDH
RIADGATADRFLATVKQRLEQWES
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacatcaaaatgccccaactcggcgagagcgttaccgaaggtactgttggccgc
tggctgaaacggcccggcgaaccggtcgcgaaatacgaaccgttgttggaagtagttacc
gataaggtcgatacggaggtaccggcgcctgaagctggtgttctccacgagattttggtt
cccgaaggtgagacggtacgggtgggaacggtgatcgcacggctcgccccggcaggagct
gcggtgagcacgccaacaccggtggctgcgacgagtgctgtagcagtctccacgaccagt
gcctcggcaaccaccacgacaacggtggctccaccggccagtgatgggcgtaatacctat
ctctcgccggtcgtagcgcggttgctcgccgaacacaaccttgatccggcgcagattcgc
ggtactggacaaggcgggcgtattaccaaacaagatgttatgcgcttcctcgccgaacgt
gaacgccaggcggtgaacgcgccggctcccacacccgcgccggtcgctgctcctaccccg
gctcccacacccgcgccggtcgctgctcctaccccgatgcctacacccgcgccggtcgct
gctccttcgccgacgcccgcgcccacaccggttgagattcctgctgacgctgaattggtg
ccattgacgccaatgcggcgcagcattgccgagcatatggctcgctcggtacgcacctcg
ccgcacgtcacaactgtgatggaggcagatttgagccgcgtgctcgcccatcgagccgct
catcaagaagcctttaatcggcaaggtgtgcgtctcacgcttaccccatatttcatcatt
gccgctattgccggactacaagccgtaccggtattcaacggcagcttcaccgagcaaggt
atcatcctacatcgccgtattaatgtggggattgcagttgcgctcaacgaaggtctattg
gtaccggtcattcctgatgctgacgagaagaatctgctcggcctggcccgtgccgtcaac
gatctcgccgaacgggcacgtaccaggcgtttgcgcccagaagaaacacaaggtggtacg
ttcaccatcacgaaccacggggtgaccggtagcctgtttgcaacgccgatcatcaatcag
ccgcaggccggtattctcggtatcggtgcagtggtcaaacgaccggtcgttatttcccaa
aatgggcttgatgccatcgccattcgtccgctctgctatctctcgtttaccttcgatcac
cggattgccgatggcgccactgccgaccgattcctcgctaccgttaaacaacggctcgaa
cagtgggagagttaa

DBGET integrated database retrieval system