KEGG   Catenulispora acidiphila: Caci_6584Help
Entry
Caci_6584         CDS       T00967                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
cai  Catenulispora acidiphila
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(7593934..7595061)
Genome map
AA seq 375 aa AA seqDB search
MRFHRLAAVGVAVATAVAAAITGSGVAGASSSSSDSLRALASKIDLHIGTAVVPYDLDNP
DYAKIAATQFSVVTPGNEMKWQVVEPTQGTYDWSGGDRLVQFAQQNHQLVRGHVLLWHNQ
LPDWLTTGVTNGTISDAQLRDLLHKHITDEVTHFKGKIWQWDVANEFFTDDNPSQLNPND
FWISHLGTGVIADAFRWAHAADPKALLFYNDYNIAGEDGTNAKSDAAYTFIKQLVAQGVP
ISGVGDQGHLDTQYGFPTKMTDDLQRFANLGLKTAITEADVRTFVDSPTTQVPTDHLATF
AQPYEYSQMLQACLAVKQCISFTVWGFGDTDSWIPGWFTNEGYANLYDVNLAPKPVVADL
QQDLKLAAHGAQHRS
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaggttccaccgtctggccgcagtaggcgtcgccgtggcgaccgccgtcgcggccgcg
atcacgggctcgggcgtcgccggggcgagctcgagctcctccgactcgcttcgtgcgctg
gcctcgaagatcgacctgcatatcgggaccgccgtcgtcccctatgacctcgacaacccg
gactacgccaagatcgccgcgacccagttctcggtggtcacgcccggcaacgagatgaag
tggcaggtggtggagccgacgcagggcacgtacgactggtccggcggcgaccgcctggtg
cagttcgcgcagcagaatcaccaactcgtccgcggccacgtcctgctgtggcacaaccag
cttccggactggctgaccaccggcgtcaccaacggcacgatcagtgacgcgcagctgcgc
gacctgctgcacaagcacatcaccgacgaggtgacgcacttcaagggcaagatctggcag
tgggacgtcgcgaacgagttcttcaccgacgacaacccgtcccagctgaacccgaacgac
ttctggatctcgcacctgggcaccggcgtcatagccgacgccttccgctgggcccacgcc
gccgacccgaaggcgctcctgttctacaacgactacaacatcgccggcgaggacggaacc
aacgccaagagcgacgccgcctacaccttcatcaagcagctggtcgcccaaggcgtcccg
atcagcggcgtcggcgaccagggccacctcgacacgcagtacggcttccccacaaagatg
accgacgacctccagcgcttcgccaacctcggcctgaagaccgccatcaccgaagccgac
gtccgcaccttcgtggacagccccaccacccaagtccccaccgaccacctggccaccttc
gcccagccatacgagtactcccagatgctccaagcctgcctagccgtcaagcagtgcatc
tccttcacagtctggggcttcggcgacaccgactcctggatccccggctggttcaccaac
gagggctacgcaaacctctacgacgtcaacctcgcccccaagcccgtcgtcgcagacctg
cagcaagacctgaaactcgccgcccacggcgcccagcaccgcagctga

DBGET integrated database retrieval system