KEGG   Cicer arietinum (chickpea): 101492564Help
Entry
101492564         CDS       T02819                                 

Definition
4-alpha-glucanotransferase, chloroplastic/amyloplastic-like
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cam  Cicer arietinum (chickpea)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101492564
Enzymes [BR:cam01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     101492564
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca5
AA seq 567 aa AA seqDB search
MSLTLTLSLIPQVHRWTSSPILKFKSNSPHSFNCASSLSSTSFNQLTVGEDFPLNYGDWL
PKPQLHLRRRAGILLHPTSFQGPYGIGDLGNEAFRFIDWLHRTGCSLWQVLPLVPPGRKA
NEEGSPYSGQDANCGNTLLISLEELVEDGLLEKHELPKPIDAERVNFSAVADLKDPLITK
AAQRLISSKGELKTQLETFRRDPSISSWLEDAAYFAAIDDSLNTLSWYEWPEPLKNRHLV
ALEDIYEQKQDFINVFIAQQFLFQKQWQKVRNYAQSRGIRIMGDMPIYVGYHSADVWANK
NQFALNRKGFPILVSGVPPDAFSETGQLWGSPLYDWKAMEQEGYSWWIRRLRRAQDLYDE
FRIDHFRGFAGFWAVPSEAKVAMVGKWKVGPGISFFDAIFGAIGRMDITAEDLGVITEDV
VQLRKSIGAPGMAVLQFGFGGGAGNPHLPHNHECNQVVYTGTHDNDTIKGWWEALNQEEK
SHVLSYVSLTGEEDISWALIQTALASVGQTAIIPMQDVLGLGSSARMNIPATQFGNWGWR
VPSSVSFDRLEREATRLKEMLSMYGRL
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgactctgactttgagtctcatcccacaagtacaccggtggacctcatcgcca
attctcaaattcaaatccaattcaccacattccttcaattgtgcttcttctttgtcttcc
acttcctttaatcaactcactgttggtgaagattttccgctaaactacggtgattggctt
cccaagccccaacttcatcttcgcagaagagccggtattctactccatccgacgtcgttt
caaggcccttatggaatcggtgatctcggaaacgaggcttttcgtttcattgattggctt
caccgaaccggttgctccctttggcaggttcttcctctggtgcctcctggcagaaaggct
aatgaagagggatccccttactcaggccaggatgcgaattgtggcaacacccttttgatt
tctcttgaagagcttgttgaggatggattgttggaaaaacatgagcttcctaaaccaatt
gatgcagagcgagtgaatttttctgctgttgctgatcttaaggatcctttgataactaaa
gctgcacagaggctaatttcaagcaaaggggaactcaaaacacagcttgagacttttcgt
agggatcctagcatatcaagttggcttgaagatgcagcttattttgctgctattgacgac
agtttaaacacactcagctggtacgagtggcccgagcctttaaaaaaccgccatcttgta
gctctagaagatatttacgaacaaaagcaagattttataaatgtatttattgcccaacaa
ttcttgttccaaaagcaatggcagaaagttcgcaattatgcgcagagtaggggaattagg
ataatgggagacatgcccatttatgttggttatcatagtgcagatgtttgggcaaataag
aaccagtttgcactgaacaggaaaggctttcctattttagtaagtggtgttcctccggat
gcattcagcgaaactggtcagctgtggggaagccccctgtatgattggaaagccatggag
caagaaggatactcatggtggatacgccgcctacggcgtgcacaggatttatatgacgaa
tttaggatcgaccactttagaggatttgctggattttgggctgttccctctgaagccaaa
gtcgctatggttggaaagtggaaggtaggacctggaatttccttctttgatgccattttc
ggagctattggaaggatggatatcacagcagaagacttaggagttatcactgaggatgta
gtgcaactaagaaaatccattggagcccctggaatggctgtccttcagtttgggtttgga
ggtggcgccggtaaccctcatttgcctcataatcacgagtgcaatcaagttgtctataca
gggactcatgacaatgacacgattaagggttggtgggaagctttaaaccaagaagagaaa
tcccatgtattaagttatgtttcattaactggagaagaagatatttcgtgggcactaata
cagacagcgctggcctctgttggtcaaacagcaataatacctatgcaagatgttcttgga
ctagggagttctgccaggatgaatattcctgctactcagtttggaaactggggatggagg
gttccaagttctgtgagctttgacaggttagaaagagaggcaactagactcaaagagatg
ctttcaatgtatggccggctttga

DBGET integrated database retrieval system