KEGG   Cicer arietinum (chickpea): 101495366Help
Entry
101495366         CDS       T02819                                 

Definition
palmitoyl-monogalactosyldiacylglycerol delta-7 desaturase, chloroplastic-like
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cam  Cicer arietinum (chickpea)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    101495366
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    101495366
Enzymes [BR:cam01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     101495366
Lipid biosynthesis proteins [BR:cam01004]
 Desaturase
  First
   101495366
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca6
AA seq 393 aa AA seqDB search
MALITSQPKNPILHNHFTTLHCSIPQFNRSKLTFGSFSNNVKTNKVCNFNTNSIKFQLKK
NNPFTYNLPIIAKSNAAIGEASLEQEEEVPLKYRKIFLSDVEVKRERKLFLGRKWNSLDV
ATAGIVLSMHLLCLFAPFNFNWPAFWVAVSLYVVTGLFGITLSFHRHLSHKSFKLPKLLE
YLFAYCGVLALQGNPIDWVSTHRYHHQFCDSEKDPHSPIEGFWFSHMSWLFDTNAMVERY
GKPTNVGDLEKQSFYRFIRSTYILHPFALGALLYAIGGFPFIVWGMGVRIVWVYHITWLV
NSACHVWGNQPWNTKDLSTNNWWVALLAFGEGWHNNHHAFEYSARHGLEWWEIDMTWYMV
KFLQAIGLATEVKVPSDIQKQRMAFNNNDGIAT
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgataacttctcaacccaaaaaccccattctccataatcacttcacaactctt
cattgttcaattccacaattcaataggtccaaattaacatttgggtcattctcaaacaat
gtaaaaaccaataaagtttgtaactttaacacaaattcaataaaatttcagttgaaaaaa
aacaacccttttacttataatcttccaattatagctaaatccaatgctgcaattggagaa
gcttctttggaacaagaggaagaagttccattgaaatacagaaagatttttctatctgat
gttgaagtgaagagagaaaggaaattatttttgggtaggaaatggaattcattggatgtt
gcaacagctggaattgtattgtcaatgcatttgttatgcttatttgctccattcaatttc
aattggccagctttttgggttgctgtttctctttatgttgttactggtctctttggaatc
acactgtctttccatagacatctttctcataaaagttttaagcttcctaaattgcttgaa
tatttgtttgcttattgtggtgttcttgctcttcagggaaatccaattgattgggttagc
actcataggtatcatcaccagttttgtgattctgagaaggaccctcatagccctattgaa
ggattttggtttagccatatgagttggttatttgataccaatgctatggtagaaaggtat
ggaaaaccaaccaatgttggtgatttagagaaacagtcattttatagatttatcagaagc
acttacattttgcatccatttgctttgggagctcttctatatgctattggtggattccct
tttattgtttggggaatgggagtgaggattgtttgggtttaccacatcacttggcttgta
aattcagcttgccatgtttgggggaatcagccttggaacacaaaggacttatcaacaaat
aattggtgggtggctttgcttgcatttggtgaaggttggcacaataaccaccatgcattt
gaatattcagctagacatggtttagagtggtgggaaatagacatgacttggtacatggtc
aaatttcttcaagctattggtttggcaactgaagtgaaagtaccaagtgatatacaaaag
caaagaatggcattcaataataatgatggaatagccacatga

  All links  
No link information was found.   
DBGET integrated database retrieval system