KEGG   Cyanobacterium aponinum: Cyan10605_1585Help
Entry
Cyan10605_1585    CDS       T02376                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
can  Cyanobacterium aponinum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:can00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cyan10605_1585
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan10605_1585
   00052 Galactose metabolism
    Cyan10605_1585
   00500 Starch and sucrose metabolism
    Cyan10605_1585
   00520 Amino sugar and nucleotide sugar metabolism
    Cyan10605_1585
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cyan10605_1585
   00524 Butirosin and neomycin biosynthesis
    Cyan10605_1585
Enzymes [BR:can01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cyan10605_1585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1908399..1909295
Genome map
AA seq 298 aa AA seqDB search
MQPEVIGVDLGGTAIKLGRFTQDGSCLESVTIPTPQPATPKAVIDAIASMVKQLNSQNQA
IAIGVGTPGPTDTQGRIALVAINLTGWENVPLADELEAKTGLKTTIANDANCAGLGEAWL
GAGKNYHNSILLTLGTGVGGAIIINDKLFTGHLGAAGELGLITLNPDGPPCNSGNRGSLE
QYVSATAIIRETGKNPAELATLAEQNDSTALMFWHNYGKQLGAGLASLIYILTPEVVIIG
GGVSAGAKYFLSSTQKEIEKRVLPSSRINLKITVAQLGNQAGMVGAAKLAWDKGKIKN
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccagaagttattggcgttgatttaggtggtactgcgataaaattaggtcgcttc
actcaagatggtagttgtttggaatccgttaccattcctactccccaacctgccactccc
aaagcggtaatagatgcgatcgcatctatggttaaacaattaaatagccaaaaccaagcc
atagccataggtgtaggaactcccggacctactgatactcaaggcagaatcgcccttgtt
gccattaatttaacaggatgggaaaatgtacccctagccgatgaattagaagcaaaaaca
ggcttaaaaaccaccattgccaatgatgccaactgtgccggattaggggaagcgtggtta
ggtgcaggaaaaaattatcataactccattctcttgacattaggtacaggagttggagga
gcaattattatcaacgacaaactatttacagggcatttaggagcggcgggagagctagga
ttaatcacccttaatcctgatggccccccctgcaatagtggtaatcgaggctcattagag
cagtatgtttcagctacagcaatcattcgtgaaacaggaaaaaacccggcagagttagca
acccttgccgaacaaaacgactctaccgccttgatgttttggcacaattatgggaaacaa
ttaggggcaggattagccagtttaatttatatccttactcccgaagttgttattattggg
ggaggagtttcggctggtgcaaaatactttctctcttccacacaaaaagaaatcgaaaaa
agagtcttacccagttctcgtattaacctaaaaataacagttgctcaattaggaaatcaa
gcgggaatggtgggagcggcaaaattagcatgggacaaaggaaaaattaagaattaa

DBGET integrated database retrieval system