KEGG   Chloroflexus aurantiacus: Caur_1720Help
Entry
Caur_1720         CDS       T00639                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cau  Chloroflexus aurantiacus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Caur_1720
Enzymes [BR:cau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Caur_1720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2361619..2362530
Genome map
AA seq 303 aa AA seqDB search
MTPTIVVVGSLNMDLVVRAPRHPQPGETVIGSDFQTFPGGKGANQAVAAARLGARVHLVG
RVGVDAFGHTLLATAQEHGVDTTFVQRDPTAPTGVALITIDSHGQNTIVVAPGANMQVTE
ADVLRAESVLATADMLLMQLECPLEVVIAAARLAHHHGVPVVLNPAPARPLPVDLLALVD
FLIPNQLELQALAEGEADLRTAIRYLQQRGARNVVVTLAEAGAVLAEADQIIHEPAFEVP
VVDTVAAGDAFVAAFCVASASGKSPQEAVRWGNAAGALAVTREGAQPSLPAYREVLRLLK
VSG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgactcctacgattgtggttgtcggtagcctgaacatggatctggtagtgcgcgcacca
cgccatccacaaccgggagagacggttattggtagtgattttcaaacctttccgggtggt
aaaggggcaaatcaggcggtggccgcagcccggttgggagcacgtgttcaccttgtcggg
cgggtgggagtagatgcgttcggtcataccctgctggcgacagcccaagagcacggcgtc
gataccacctttgtccagcgtgacccgacggcacctaccggtgttgcgctgattaccatt
gactctcacggtcaaaatacgatagttgtcgcgccgggtgcgaatatgcaggtaacggaa
gcggatgtgctacgtgcagagtcggtgctggccacggctgatatgctgttgatgcaactt
gaatgtccgcttgaggtcgtgattgcggcggcccgcctggctcatcatcacggtgttccg
gtggtgttaaatccggccccggcccgtccgttaccggttgatctgttggcgctggttgat
ttcctcattcccaatcagcttgaattgcaagcccttgccgaaggtgaagccgatctgcgc
accgcaattcgctatctgcaacaacgtggtgctcgcaatgtggtggttaccctggctgaa
gccggcgcggtcctggccgaagccgatcagatcatccacgagccggcgttcgaggtaccg
gttgtcgatacggtggcggcgggtgatgcgtttgttgctgctttctgcgttgccagcgcc
agcggcaaatcgccgcaggaggctgtacgttggggaaacgcagccggtgcgctggcagtc
acccgtgaaggtgcgcagccgtcattgccggcctatcgagaggtgctgcggttgttgaag
gttagtgggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system